Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00
PubTator Score 0.25

Knowledge Summary

Patent (130)

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
lung cancer 4740 0.0 0.5

AA Sequence

MNPANHSQVAGFVLLGLSQVWELRFVFFTVFSAVYFMTVVGNLLIVVIVTSDPHLHTTMYFLLGNLSFLD      1 - 70
FCYSSITAPRMLVDLLSGNPTISFGGCLTQLFFFHFIGGIKIFLLTVMAYDRYIAISQPLHYTLIMNQTV     71 - 140
CALLMAASWVGGFIHSIVQIALTIQLPFCGPDKLDNFYCDVPQLIKLACTDTFVLELLMVSNNGLVTLMC    141 - 210
FLVLLGSYTALLVMLRSHSREGRSKALSTCASHIAVVTLIFVPCIYVYTRPFRTFPMDKAVSVLYTIVTP    211 - 280
MLNPAIYTLRNKEVIMAMKKLWRRKKDPIGPLEHRPLH                                    281 - 318
//

Text Mined References (3)

PMID Year Title