Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.17

Knowledge Summary

Patent (158)


  Disease (1)

Disease Target Count Z-score Confidence
Hemolytic anemia 70 0.0 2.0

Gene RIF (1)

20677014 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

VCILAPPMLNPIIYGIKTKQIQEQVVQFLFIKQK                                        281 - 314

Text Mined References (8)

PMID Year Title
23227193 2012 Analysis of copy number variation in Alzheimer's disease in a cohort of clinically characterized and neuropathologically verified individuals.
22908908 2012 Personal receptor repertoires: olfaction as a model.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
16939646 2006 A probabilistic classifier for olfactory receptor pseudogenes.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
14983052 2004 The human olfactory receptor gene family.
12730696 2003 Different noses for different people.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.