Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.11
PubTator Score 0.14

Knowledge Summary

Patent (136)

TINX Plot

  Disease Relevance (2)

AA Sequence

MSIINTSYVEITTFFLVGMPGLEYAHIWISIPICSMYLIAILGNGTILFIIKTEPSLHEPMYYFLSMLAM      1 - 70
SDLGLSLSSLPTVLSIFLFNAPEISSNACFAQEFFIHGFSVLESSVLLIMSFDRFLAIHNPLRYTSILTT     71 - 140
VRVAQIGIVFSFKSMLLVLPFPFTLRNLRYCKKNQLSHSYCLHQDVMKLACSDNRIDVIYGFFGALCLMV    141 - 210
DFILIAVSYTLILKTVLGIASKKEQLKALNTCVSHICAVIIFYLPIINLAVVHRFARHVSPLINVLMANV    211 - 280
LLLVPPLTNPIVYCVKTKQIRVRVVAKLCQRKI                                         281 - 313
//

Text Mined References (1)

PMID Year Title
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.