Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.11
PubTator Score 0.14

Knowledge Summary

Patent (136)

TINX Plot

  Disease (3)

Disease Target Count P-value
diabetes mellitus 1728 1.1e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Anorexia nervosa 80 3.629 1.8

AA Sequence

MSIINTSYVEITTFFLVGMPGLEYAHIWISIPICSMYLIAILGNGTILFIIKTEPSLHEPMYYFLSMLAM      1 - 70
SDLGLSLSSLPTVLSIFLFNAPEISSNACFAQEFFIHGFSVLESSVLLIMSFDRFLAIHNPLRYTSILTT     71 - 140
VRVAQIGIVFSFKSMLLVLPFPFTLRNLRYCKKNQLSHSYCLHQDVMKLACSDNRIDVIYGFFGALCLMV    141 - 210
DFILIAVSYTLILKTVLGIASKKEQLKALNTCVSHICAVIIFYLPIINLAVVHRFARHVSPLINVLMANV    211 - 280
LLLVPPLTNPIVYCVKTKQIRVRVVAKLCQRKI                                         281 - 313
//

Text Mined References (1)

PMID Year Title