Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.61
PubTator Score 1.14

Knowledge Summary

Patent (267)

TINX Plot

  Disease Relevance (3)

AA Sequence

MGDWNNSDAVEPIFILRGFPGLEYVHSWLSILFCLAYLVAFMGNVTILSVIWIESSLHQPMYYFISILAV      1 - 70
NDLGMSLSTLPTMLAVLWLDAPEIQASACYAQLFFIHTFTFLESSVLLAMAFDRFVAICHPLHYPTILTN     71 - 140
SVIGKIGLACLLRSLGVVLPTPLLLRHYHYCHGNALSHAFCLHQDVLRLSCTDARTNSIYGLCVVIATLG    141 - 210
VDSIFILLSYVLILNTVLDIASREEQLKALNTCVSHICVVLIFFVPVIGVSMVHRFGKHLSPIVHILMAD    211 - 280
IYLLLPPVLNPIVYSVRTKQIRLGILHKFVLRRRF                                       281 - 315
//

Text Mined References (2)

PMID Year Title
23406172 2013 Genetic determinants of haemolysis in sickle cell anaemia.
14983052 2004 The human olfactory receptor gene family.