Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.61
PubTator Score 1.14

Knowledge Summary

Patent (267)

TINX Plot

  Disease (3)

Disease Target Count P-value
diabetes mellitus 1728 1.2e-03
Disease Target Count Z-score Confidence
Hemolytic anemia 77 0.0 3.0
Disease Target Count Z-score Confidence
Anorexia nervosa 80 3.405 1.7

AA Sequence

MGDWNNSDAVEPIFILRGFPGLEYVHSWLSILFCLAYLVAFMGNVTILSVIWIESSLHQPMYYFISILAV      1 - 70
NDLGMSLSTLPTMLAVLWLDAPEIQASACYAQLFFIHTFTFLESSVLLAMAFDRFVAICHPLHYPTILTN     71 - 140
SVIGKIGLACLLRSLGVVLPTPLLLRHYHYCHGNALSHAFCLHQDVLRLSCTDARTNSIYGLCVVIATLG    141 - 210
VDSIFILLSYVLILNTVLDIASREEQLKALNTCVSHICVVLIFFVPVIGVSMVHRFGKHLSPIVHILMAD    211 - 280
IYLLLPPVLNPIVYSVRTKQIRLGILHKFVLRRRF                                       281 - 315
//

Text Mined References (2)

PMID Year Title