Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.35

Knowledge Summary

Patent (148)

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Oropharynx cancer 9 3.93 2.0

Expression

AA Sequence

MSGDNSSSLTPGFFILNGVPGLEATHIWISLPFCFMYIIAVVGNCGLICLISHEEALHRPMYYFLALLSF      1 - 70
TDVTLCTTMVPNMLCIFWFNLKEIDFNACLAQMFFVHMLTGMESGVLMLMALDRYVAICYPLRYATILTN     71 - 140
PVIAKAGLATFLRNVMLIIPFTLLTKRLPYCRGNFIPHTYCDHMSVAKVSCGNFKVNAIYGLMVALLIGV    141 - 210
FDICCISVSYTMILQAVMSLSSADARHKAFSTCTSHMCSIVITYVAAFFTFFTHRFVGHNIPNHIHIIVA    211 - 280
NLYLLLPPTMNPIVYGVKTKQIQEGVIKFLLGDKVSFTYDK                                 281 - 321
//

Text Mined References (2)

PMID Year Title