Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.50
PubTator Score 0.25

Knowledge Summary

Patent (209)

AA Sequence

MLARNNSLVTEFILAGLTDHPEFQQPLFFLFLVVYIVTMVGNLGLIILFGLNSHLHTPMYYFLFNLSFID      1 - 70
LCYSSVFTPKMLMNFVSKKNIISYVGCMTQLFFFLFFVISECYMLTSMAYDRYVAICNPLLYKVTMSHQV     71 - 140
CSMLTFAAYIMGLAGATAHTGCMLRLTFCSANIINHYLCDILPLLQLSCTSTYVNEVVVLIVVGINIMVP    141 - 210
SCTILISYVFIVTSILHIKSTQGRSKAFSTCSSHVIALSLFFGSAAFMYIKYSSGSMEQGKVSSVFYTNV    211 - 280
VPMLNPLIYSLRNKDVKVALRKALIKIQRRNIF                                         281 - 313
//

Text Mined References (2)

PMID Year Title
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
14983052 2004 The human olfactory receptor gene family.