Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

MASGNLTWVTEFILVGVSDDPELQIPLFLVFLVLYLLTVAGNLGIITLTSVDPQLQTPMYFFLRHLAIIN      1 - 70
LCNSTVVAPKMLVNFLVTKKTISYYGCAAQLGGFLVFIVAEIFTLAAMAYDRYVAIWSPLLYAVVVSPKV     71 - 140
CRLLVSLTYLQSLITALTVSSCVFSVSYCSSNIINHFYCDDVPLLALSCSDTYIPETAVFIFSGTNLLFS    141 - 210
MIVVLISYFNIVITILRIRSSEGRQKAFSTCASHMIAVVVFYGTLLFMYLQPRSNHSLDTDKMASVFYTL    211 - 280
VIPVLNPLIYSLRNKNVKDALKRFLDNPCRSLKLM                                       281 - 315
//

Text Mined References (4)

PMID Year Title
18989455 2008 High-resolution copy-number variation map reflects human olfactory receptor diversity and evolution.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
12908129 2003 Natural selection on the olfactory receptor gene family in humans and chimpanzees.
12730696 2003 Different noses for different people.