Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.40
PubTator Score 3.83

Knowledge Summary

Patent (92)

Expression

AA Sequence

MLRNGSIVTEFILVGFQQSSTSTRALLFALFLALYSLTMAMNGLIIFITSWTDPKLNSPMYFFLGHLSLL      1 - 70
DVCFITTTIPQMLIHLVVRDHIVSFVCCMTQMYFVFCVGVAECILLAFMAYDRYVAICYPLNYVPIISQK     71 - 140
VCVRLVGTAWFFGLINGIFLEYISFREPFRRDNHIESFFCEAPIVIGLSCGDPQFSLWAIFADAIVVILS    141 - 210
PMVLTVTSYVHILATILSKASSSGRGKTFSTCASHLTVVIFLYTSAMFSYMNPHSTHGPDKDKPFSLLYT    211 - 280
IITPMCNPIIYSFRNKEIKEAMVRALGRTRLAQPQSV                                     281 - 317
//

Text Mined References (4)

PMID Year Title