Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary

Patent (114)

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

AA Sequence

MDEANHSVVSEFVFLGLSDSRKIQLLLFLFFSVFYVSSLMGNLLIVLTVTSDPRLQSPMYFLLANLSIIN      1 - 70
LVFCSSTAPKMIYDLFRKHKTISFGGCVVQIFFIHAVGGTEMVLLIAMAFDRYVAICKPLHYLTIMNPQR     71 - 140
CILFLVISWIIGIIHSVIQLAFVVDLLFCGPNELDSFFCDLPRFIKLACIETYTLGFMVTANSGFISLAS    141 - 210
FLILIISYIFILVTVQKKSSGGIFKAFSMLSAHVIVVVLVFGPLIFFYIFPFPTSHLDKFLAIFDAVITP    211 - 280
VLNPVIYTFRNKEMMVAMRRRCSQFVNYSKIF                                          281 - 312
//

Text Mined References (3)

PMID Year Title