Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00
PubTator Score 0.83

Knowledge Summary

Patent (358)

AA Sequence

MEARNQTAISKFLLLGLIEDPELQPVLFSLFLSMYLVTILGNLLILLAVISDSHLHTPMYFFLSNLSFLD      1 - 70
ICLSTTTIPKMLVNIQAQNRSITYSGCLTQICFVLFFAGLENCLLAAMAYDRYVAICHPLRYTVIMNPRL     71 - 140
CGLLILLSLLTSVVNALLLSLMVLRLSFCTDLEIPLFFCELAQVIQLTCSDTLINNILIYFAACIFGGVP    141 - 210
LSGIILSYTQITSCVLRMPSASGKHKAVSTCGSHLSIVLLFYGAGLGVYISSVVTDSPRKTAVASVMYSV    211 - 280
FPQMVNPFIYSLRNKDMKGTLRKFIGRIPSLLWCAICFGFRFLE                              281 - 324
//

Text Mined References (3)

PMID Year Title
15057824 2004 The DNA sequence and biology of human chromosome 19.
14983052 2004 The human olfactory receptor gene family.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.