Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00
PubTator Score 49.42

Knowledge Summary

Patent (393)

TINX Plot

  Disease (2)

Disease Target Count P-value
diabetes mellitus 1728 1.0e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

AA Sequence

MGDVNQSVASDFILVGLFSHSGSRQLLFSLVAVMFVIGLLGNTVLLFLIRVDSRLHTPMYFLLSQLSLFD      1 - 70
IGCPMVTIPKMASDFLRGEGATSYGGGAAQIFFLTLMGVAEGVLLVLMSYDRYVAVCQPLQYPVLMRRQV     71 - 140
CLLMMGSSWVVGVLNASIQTSITLHFPYCASRIVDHFFCEVPALLKLSCADTCAYEMALSTSGVLILMLP    141 - 210
LSLIATSYGHVLQAVLSMRSEEARHKAVTTCSSHITVVGLFYGAAVFMYMVPCAYHSPQQDNVVSLFYSL    211 - 280
VTPTLNPLIYSLRNPEVWMALVKVLSRAGLRQMC                                        281 - 314
//

Text Mined References (5)

PMID Year Title