Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.14
PubTator Score 0.83

Knowledge Summary

Patent (256)

Gene RIF (1)

AA Sequence

MKAGNFSDTPEFFLLGLSGDPELQPILFMLFLSMYLATMLGNLLIILAVNSDSHLHTPMYFLLSILSLVD      1 - 70
ICFTSTTMPKMLVNIQAQAQSINYTGCLTQICFVLVFVGLENGILVMMAYDRFVAICHPLRYNVIMNPKL     71 - 140
CGLLLLLSFIVSVLDALLHTLMVLQLTFCIDLEIPHFFCELAHILKLACSDVLINNILVYLVTSLLGVVP    141 - 210
LSGIIFSYTRIVSSVMKIPSAGGKYKAFSICGSHLIVVSLFYGTGFGVYLSSGATHSSRKGAIASVMYTV    211 - 280
VTPMLNPLIYSLRNKDMLKALRKLISRIPSFH                                          281 - 312
//

Text Mined References (3)

PMID Year Title