Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.14
PubTator Score 0.83

Knowledge Summary

Patent (256)

Gene RIF (1)

PMID Text
22044667 The SNP in the OR7G3 gene (rs10414255) was found to be associated with adiposity and eating behaviors.

AA Sequence

MKAGNFSDTPEFFLLGLSGDPELQPILFMLFLSMYLATMLGNLLIILAVNSDSHLHTPMYFLLSILSLVD      1 - 70
ICFTSTTMPKMLVNIQAQAQSINYTGCLTQICFVLVFVGLENGILVMMAYDRFVAICHPLRYNVIMNPKL     71 - 140
CGLLLLLSFIVSVLDALLHTLMVLQLTFCIDLEIPHFFCELAHILKLACSDVLINNILVYLVTSLLGVVP    141 - 210
LSGIIFSYTRIVSSVMKIPSAGGKYKAFSICGSHLIVVSLFYGTGFGVYLSSGATHSSRKGAIASVMYTV    211 - 280
VTPMLNPLIYSLRNKDMLKALRKLISRIPSFH                                          281 - 312
//

Text Mined References (3)

PMID Year Title
22044667 2012 Association between olfactory receptor genes, eating behavior traits and adiposity: results from the Quebec Family Study.
14983052 2004 The human olfactory receptor gene family.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.