Property Summary

NCBI Gene PubMed Count 8
PubMed Score 10.54
PubTator Score 0.25

Knowledge Summary

Patent (558)

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Panic disorder 61 3.615 1.8
Periventricular nodular heterotopia 30 3.379 1.7

AA Sequence

MAMDNVTAVFQFLLIGISNYPQWRDTFFTLVLIIYLSTLLGNGFMIFLIHFDPNLHTPIYFFLSNLSFLD      1 - 70
LCYGTASMPQALVHCFSTHPYLSYPRCLAQTSVSLALATAECLLLAAMAYDRVVAISNPLRYSVVMNGPV     71 - 140
CVCLVATSWGTSLVLTAMLILSLRLHFCGANVINHFACEILSLIKLTCSDTSLNEFMILITSIFTLLLPF    141 - 210
GFVLLSYIRIAMAIIRIRSLQGRLKAFTTCGSHLTVVTIFYGSAISMYMKTQSKSYPDQDKFISVFYGAL    211 - 280
TPMLNPLIYSLRKKDVKRAIRKVMLKRT                                              281 - 308
//

Text Mined References (9)

PMID Year Title