Property Summary

NCBI Gene PubMed Count 8
Grant Count 3
Funding $254,426
PubMed Score 8.61
PubTator Score 0.25

Knowledge Summary

Patent (558)

TINX Plot

  Disease Relevance (2)

AA Sequence

MAMDNVTAVFQFLLIGISNYPQWRDTFFTLVLIIYLSTLLGNGFMIFLIHFDPNLHTPIYFFLSNLSFLD      1 - 70
LCYGTASMPQALVHCFSTHPYLSYPRCLAQTSVSLALATAECLLLAAMAYDRVVAISNPLRYSVVMNGPV     71 - 140
CVCLVATSWGTSLVLTAMLILSLRLHFCGANVINHFACEILSLIKLTCSDTSLNEFMILITSIFTLLLPF    141 - 210
GFVLLSYIRIAMAIIRIRSLQGRLKAFTTCGSHLTVVTIFYGSAISMYMKTQSKSYPDQDKFISVFYGAL    211 - 280
TPMLNPLIYSLRKKDVKRAIRKVMLKRT                                              281 - 308
//

Text Mined References (9)

PMID Year Title
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983052 2004 The human olfactory receptor gene family.
12908129 2003 Natural selection on the olfactory receptor gene family in humans and chimpanzees.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.
9268701 1997 Molecular cloning and chromosomal mapping of olfactory receptor genes expressed in the male germ line: evidence for their wide distribution in the human genome.
1840504 1991 A novel multigene family may encode odorant receptors: a molecular basis for odor recognition.
1370859 1992 Expression of members of the putative olfactory receptor gene family in mammalian germ cells.