Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.84
PubTator Score 20.04

Knowledge Summary

Patent (89)

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
lung cancer 4740 0.0 0.5

AA Sequence

MARENSTFNSDFILLGIFNHSPTHTFLFFLVLAIFSVAFMGNSVMVLLIYLDTQLHTPMYLLLSQLSLMD      1 - 70
LMLICTTVPKMAFNYLSGSKSISMAGCATQIFFYTSLLGSECFLLAVMAYDRYTAICHPLRYTNLMSPKI     71 - 140
CGLMTAFSWILGSTDGIIDVVATFSFSYCGSREIAHFFCDFPSLLILSCSDTSIFEKILFICCIVMIVFP    141 - 210
VAIIIASYARVILAVIHMGSGEGRRKAFTTCSSHLLVVGMYYGAALFMYIRPTSDRSPTQDKMVSVFYTI    211 - 280
LTPMLNPLIYSLRNKEVTRAFMKILGKGKSGE                                          281 - 312
//

Text Mined References (5)

PMID Year Title