Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.07
PubTator Score 12.07

Knowledge Summary

Patent (94)

Gene RIF (1)

PMID Text
20585627 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAWENQTFNSDFLLLGIFNHSPTHTFLFFLVLAIFSVAFMGNSIMVLLIYLDTQLHTPMYFLLSQLSLMD      1 - 70
LMLICTTVPKMAFNYLSGSKSISMAGCATQIFFYISLLGSECFLLAVMSYDRYTAICHPLRYTNLMRPKI     71 - 140
CGLMTAFSWILGSTDGIIDAVATFSFSYCGSREIAHFCCDFPSLLILSCNDTSIFEEVIFICCIVMLVFP    141 - 210
VAIIITSYARVILAVIHMGSGEGRRKAFTTCSSHLMVVGMYYGAGLFMCIQPTSHHSPMQDKMVSVFYTI    211 - 280
VTPMLNPLIYSLRNKEVTRALMKILGKGKSGD                                          281 - 312
//

Text Mined References (5)

PMID Year Title
20585627 2010 Web-based, participant-driven studies yield novel genetic associations for common traits.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983052 2004 The human olfactory receptor gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.