Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.22
PubTator Score 1.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung carcinoma 2843 7.9e-23
cystic fibrosis 1696 1.6e-04
Disease Target Count Z-score Confidence
Crohn's disease 321 0.0 3.0

Expression

  Differential Expression (2)

Disease log2 FC p
cystic fibrosis 1.019 1.6e-04
lung carcinoma -1.200 7.9e-23

 GO Function (1)

Gene RIF (2)

AA Sequence

MHYYRYSNAKVSCWYKYLLFSYNIIFWLAGVVFLGVGLWAWSEKGVLSDLTKVTRMHGIDPVVLVLMVGV      1 - 70
VMFTLGFAGCVGALRENICLLNFFCGTIVLIFFLELAVAVLAFLFQDWVRDRFREFFESNIKSYRDDIDL     71 - 140
QNLIDSLQKANQCCGAYGPEDWDLNVYFNCSGASYSREKCGVPFSCCVPDPAQKVVNTQCGYDVRIQLKS    141 - 210
KWDESIFTKGCIQALESWLPRNIYIVAGVFIAISLLQIFGIFLARTLISDIEAVKAGHHF              211 - 270
//

Text Mined References (13)

PMID Year Title