Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.08
PubTator Score 1.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Inflammatory Bowel Diseases 87
Disease Target Count P-value
lung carcinoma 2844 7.9136435771525E-23
cystic fibrosis 1670 1.57518486984553E-4
Disease Target Count Z-score Confidence
Crohn's disease 304 0.0 2.0
Disease Target Count Z-score Confidence
Arrhythmogenic right ventricular cardiomyopathy 27 3.107 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
cystic fibrosis 1.019 0.000
lung carcinoma -1.200 0.000

Synonym

Accession Q8NG11 A6NHE1 B4DHY6 D3DWD7 D3DWD8 Q567U7 Q9BU34 Q9H0U1 Tspan-14
Symbols TM4SF14
DC-TM4F2

Gene

  Ortholog (14)

Gene RIF (2)

PMID Text
26668317 Data suggest that large extracellular loop of Tspan14 mediates interaction with ADAM10, promotes ADAM10 maturation/trafficking to cell surface, and affects ADAM10 substrate specificity; ADAM10/Tspan14 interact in platelets/vascular endothelial cells.
19473719 genetic alterations of TSPAN14, SLC2A13 and PHF20 could play a role in non-small-cell lung cancer promotion

AA Sequence

MHYYRYSNAKVSCWYKYLLFSYNIIFWLAGVVFLGVGLWAWSEKGVLSDLTKVTRMHGIDPVVLVLMVGV      1 - 70
VMFTLGFAGCVGALRENICLLNFFCGTIVLIFFLELAVAVLAFLFQDWVRDRFREFFESNIKSYRDDIDL     71 - 140
QNLIDSLQKANQCCGAYGPEDWDLNVYFNCSGASYSREKCGVPFSCCVPDPAQKVVNTQCGYDVRIQLKS    141 - 210
KWDESIFTKGCIQALESWLPRNIYIVAGVFIAISLLQIFGIFLARTLISDIEAVKAGHHF              211 - 270
//

Text Mined References (13)

PMID Year Title
26686862 2016 TspanC8 tetraspanins differentially regulate the cleavage of ADAM10 substrates, Notch activation and ADAM10 membrane compartmentalization.
26668317 2016 TspanC8 Tetraspanins and A Disintegrin and Metalloprotease 10 (ADAM10) Interact via Their Extracellular Regions: EVIDENCE FOR DISTINCT BINDING MECHANISMS FOR DIFFERENT TspanC8 PROTEINS.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23091066 2012 TspanC8 tetraspanins regulate ADAM10/Kuzbanian trafficking and promote Notch activation in flies and mammals.
23035126 2012 The TspanC8 subgroup of tetraspanins interacts with A disintegrin and metalloprotease 10 (ADAM10) and regulates its maturation and cell surface expression.
21269460 2011 Initial characterization of the human central proteome.
19473719 2010 Identification of genes associated with non-small-cell lung cancer promotion and progression.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
More...