Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.12
PubTator Score 1.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.100 2.7e-02
atypical teratoid / rhabdoid tumor -1.300 1.7e-02
ependymoma -1.300 3.1e-02
glioblastoma -1.100 5.2e-04
interstitial cystitis 2.300 5.6e-03
medulloblastoma, large-cell -1.500 4.4e-03
oligodendroglioma -1.300 1.3e-02
osteosarcoma -2.466 1.2e-04
primary Sjogren syndrome 2.000 6.2e-04
psoriasis 1.500 9.2e-60
tuberculosis -1.100 4.1e-03

Gene RIF (1)

AA Sequence

MAASADLSKSSPTPNGIPSSDPASDAMDPFHACSILKQLKTMYDEGQLTDIVVEVDHGKTFSCHRNVLAA      1 - 70
ISPYFRSMFTSGLTESTQKEVRIVGVEAESMDLVLNYAYTSRVILTEANVQALFTAASIFQIPSIQDQCA     71 - 140
KYMISHLDPQNSIGVFIFADHYGHQELGDRSKEYIRKKFLCVTKEQEFLQLTKDQLISILDSDDLNVDRE    141 - 210
EHVYESIIRWFEHEQNEREVHLPEIFAKCIRFPLMEDTFIEKIPPQFAQAIAKSCVEKGPSNTNGCTQRL    211 - 280
GMTASEMIICFDAAHKHSGKKQTVPCLDIVTGRVFKLCKPPNDLREVGILVSPDNDIYIAGGYRPSSSEV    281 - 350
SIDHKAENDFWMYDHSTNRWLSKPSLLRARIGCKLVYCCGKMYAIGGRVYEGDGRNSLKSVECYDSRENC    351 - 420
WTTVCAMPVAMEFHNAVEYKEKIYVLQGEFFLFYEPQKDYWGFLTPMTVPRIQGLAAVYKDSIYYIAGTC    421 - 490
GNHQRMFTVEAYDIELNKWTRKKDFPCDQSINPYLKLVLFQNKLHLFVRATQVTVEEHVFRTSRKNSLYQ    491 - 560
YDDIADQWMKVYETPDRLWDLGRHFECAVAKLYPQCLQKVL                                 561 - 601
//

Text Mined References (12)

PMID Year Title