Property Summary

NCBI Gene PubMed Count 7
Grant Count 1
Funding $20,430
PubMed Score 1.07
PubTator Score 1.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.100 0.027
ependymoma -1.600 0.000
oligodendroglioma -1.300 0.013
osteosarcoma -2.466 0.000
atypical teratoid / rhabdoid tumor -1.300 0.017
glioblastoma -1.100 0.001
medulloblastoma, large-cell -1.500 0.004
tuberculosis -1.100 0.004
interstitial cystitis 2.300 0.006
primary Sjogren syndrome 2.000 0.001
psoriasis 1.500 0.000

Synonym

Accession Q8NFY9 B4DTW6 Q96JI5
Symbols TAKRP
TA-KRP

Gene

 Grant Application (1)

Gene RIF (1)

PMID Text
19893584 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MAASADLSKSSPTPNGIPSSDPASDAMDPFHACSILKQLKTMYDEGQLTDIVVEVDHGKTFSCHRNVLAA      1 - 70
ISPYFRSMFTSGLTESTQKEVRIVGVEAESMDLVLNYAYTSRVILTEANVQALFTAASIFQIPSIQDQCA     71 - 140
KYMISHLDPQNSIGVFIFADHYGHQELGDRSKEYIRKKFLCVTKEQEFLQLTKDQLISILDSDDLNVDRE    141 - 210
EHVYESIIRWFEHEQNEREVHLPEIFAKCIRFPLMEDTFIEKIPPQFAQAIAKSCVEKGPSNTNGCTQRL    211 - 280
GMTASEMIICFDAAHKHSGKKQTVPCLDIVTGRVFKLCKPPNDLREVGILVSPDNDIYIAGGYRPSSSEV    281 - 350
SIDHKAENDFWMYDHSTNRWLSKPSLLRARIGCKLVYCCGKMYAIGGRVYEGDGRNSLKSVECYDSRENC    351 - 420
WTTVCAMPVAMEFHNAVEYKEKIYVLQGEFFLFYEPQKDYWGFLTPMTVPRIQGLAAVYKDSIYYIAGTC    421 - 490
GNHQRMFTVEAYDIELNKWTRKKDFPCDQSINPYLKLVLFQNKLHLFVRATQVTVEEHVFRTSRKNSLYQ    491 - 560
YDDIADQWMKVYETPDRLWDLGRHFECAVAKLYPQCLQKVL                                 561 - 601
//

Text Mined References (11)

PMID Year Title
23578279 2013 The novel BTB-kelch protein, KBTBD8, is located in the Golgi apparatus and translocates to the spindle apparatus during mitosis.
22797727 2012 Meta-analysis identifies multiple loci associated with kidney function-related traits in east Asian populations.
19893584 2010 Identification of 15 loci influencing height in a Korean population.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
More...