Property Summary

NCBI Gene PubMed Count 18
Grant Count 119
R01 Count 75
Funding $28,618,083.4
PubMed Score 1533.46
PubTator Score 99.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -2.300 0.029
psoriasis -1.200 0.005
glioblastoma -1.500 0.001
oligodendroglioma -1.400 0.000
osteosarcoma -1.665 0.000
atypical teratoid / rhabdoid tumor -1.500 0.000
medulloblastoma -1.100 0.000
medulloblastoma, large-cell -1.600 0.000
non-small cell lung cancer 1.068 0.000
lung cancer 1.600 0.009
adult high grade glioma -1.800 0.000
pilocytic astrocytoma -1.100 0.001
ovarian cancer -1.300 0.004

Synonym

Accession Q8NFW8 Q96AX5 Q9NQZ0
Symbols CSS

Gene

PANTHER Protein Class (2)

AA Sequence

MDSVEKGAATSVSNPRGRPSRGRPPKLQRNSRGGQGRGVEKPPHLAALILARGGSKGIPLKNIKHLAGVP      1 - 70
LIGWVLRAALDSGAFQSVWVSTDHDEIENVAKQFGAQVHRRSSEVSKDSSTSLDAIIEFLNYHNEVDIVG     71 - 140
NIQATSPCLHPTDLQKVAEMIREEGYDSVFSVVRRHQFRWSEIQKGVREVTEPLNLNPAKRPRRQDWDGE    141 - 210
LYENGSFYFAKRHLIEMGYLQGGKMAYYEMRAEHSVDIDVDIDWPIAEQRVLRYGYFGKEKLKEIKLLVC    211 - 280
NIDGCLTNGHIYVSGDQKEIISYDVKDAIGISLLKKSGIEVRLISERACSKQTLSSLKLDCKMEVSVSDK    281 - 350
LAVVDEWRKEMGLCWKEVAYLGNEVSDEECLKRVGLSGAPADACSTAQKAVGYICKCNGGRGAIREFAEH    351 - 420
ICLLMEKVNNSCQK                                                            421 - 434
//

Text Mined References (22)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21269460 2011 Initial characterization of the human central proteome.
21116278 2011 Genome-wide association with MRI atrophy measures as a quantitative trait locus for Alzheimer's disease.
19965467 2009 Haploid genetic screens in human cells identify host factors used by pathogens.
19946888 2010 Defining the membrane proteome of NK cells.
19666032 2009 A C-terminal phosphatase module conserved in vertebrate CMP-sialic acid synthetases provides a tetramerization interface for the physiologically active enzyme.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...