Property Summary

NCBI Gene PubMed Count 18
PubMed Score 1533.46
PubTator Score 99.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -2.300 2.9e-02
psoriasis -1.200 4.9e-03
glioblastoma -1.500 1.0e-03
oligodendroglioma -1.400 1.8e-17
osteosarcoma -1.665 1.5e-04
atypical teratoid / rhabdoid tumor -1.500 9.6e-05
medulloblastoma -1.100 8.9e-05
medulloblastoma, large-cell -1.600 2.6e-04
non-small cell lung cancer 1.068 1.0e-10
lung cancer 1.600 9.3e-03
adult high grade glioma -1.800 8.5e-05
pilocytic astrocytoma -1.100 8.8e-04
ovarian cancer -1.300 4.0e-03

AA Sequence

MDSVEKGAATSVSNPRGRPSRGRPPKLQRNSRGGQGRGVEKPPHLAALILARGGSKGIPLKNIKHLAGVP      1 - 70
LIGWVLRAALDSGAFQSVWVSTDHDEIENVAKQFGAQVHRRSSEVSKDSSTSLDAIIEFLNYHNEVDIVG     71 - 140
NIQATSPCLHPTDLQKVAEMIREEGYDSVFSVVRRHQFRWSEIQKGVREVTEPLNLNPAKRPRRQDWDGE    141 - 210
LYENGSFYFAKRHLIEMGYLQGGKMAYYEMRAEHSVDIDVDIDWPIAEQRVLRYGYFGKEKLKEIKLLVC    211 - 280
NIDGCLTNGHIYVSGDQKEIISYDVKDAIGISLLKKSGIEVRLISERACSKQTLSSLKLDCKMEVSVSDK    281 - 350
LAVVDEWRKEMGLCWKEVAYLGNEVSDEECLKRVGLSGAPADACSTAQKAVGYICKCNGGRGAIREFAEH    351 - 420
ICLLMEKVNNSCQK                                                            421 - 434
//

Text Mined References (22)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21269460 2011 Initial characterization of the human central proteome.
21116278 2011 Genome-wide association with MRI atrophy measures as a quantitative trait locus for Alzheimer's disease.
19965467 2009 Haploid genetic screens in human cells identify host factors used by pathogens.
19946888 2010 Defining the membrane proteome of NK cells.
19666032 2009 A C-terminal phosphatase module conserved in vertebrate CMP-sialic acid synthetases provides a tetramerization interface for the physiologically active enzyme.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12136098 2002 NotI flanking sequences: a tool for gene discovery and verification of the human genome.
11893746 2002 Nuclear localization signal of murine CMP-Neu5Ac synthetase includes residues required for both nuclear targeting and enzymatic activity.
11602804 2001 Cloning and expression of human sialic acid pathway genes to generate CMP-sialic acids in insect cells.
11546777 2001 A second uniquely human mutation affecting sialic acid biology.
9689047 1998 Mammalian cytidine 5'-monophosphate N-acetylneuraminic acid synthetase: a nuclear protein with evolutionarily conserved structural motifs.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.