Property Summary

NCBI Gene PubMed Count 2
PubMed Score 1.75
PubTator Score 0.33

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8NFV5 Q9NTH5
Symbols SPDYE
Ringo1
WBSCR19

Gene

  Ortholog (1)

Species Source
Chimp OMA EggNOG

 GO Function (1)

 Compartment GO Term (1)

Gene RIF (1)

PMID Text
12073013 This paper mentioned accessions "AF412025-2035" and "WBSCR16-WBSCR23", but AF412027 and WBSCR19 were not discussed in this paper, and the WBSCR19 information is not available from this paper.

AA Sequence

MQKHYTVAWFLYSAPGVDPSPPCRSLGWKRKREWSDESEEEPEKELAPEPEETWVVETLCGLKMKLKQQR      1 - 70
VSPILLEHHKDFNSQLAPGVDPSPPHRSFCWKRKMEWWDKSEESEEEPRKVLAPEPEEIWVAEMLCGLKM     71 - 140
KLKRRRVSLVLPEHHEAFNRLLEDPVIKRFLAWDKDLRVSDKYLLAMVIAYFSRAGFPSWQYQRLHFFLA    141 - 210
LYLANDMEEDDEDSKQNIFHFLYGKNRSRIPLLRKRRFQLYRSMNPRARKNRSHIPLVRKRRFQLRRCMN    211 - 280
PRARKNRSQIVLFQKRRFHFFCSMSCRAWVSPEELEEIQAYDPEHWVWARDRARLS                  281 - 336
//

Text Mined References (4)

PMID Year Title
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15574121 2005 Characterization of a new family of cyclin-dependent kinase activators.
12853948 2003 The DNA sequence of human chromosome 7.
12073013 2002 Identification of additional transcripts in the Williams-Beuren syndrome critical region.