Property Summary

NCBI Gene PubMed Count 2
PubMed Score 1.75
PubTator Score 0.33

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
12073013 This paper mentioned accessions "AF412025-2035" and "WBSCR16-WBSCR23", but AF412027 and WBSCR19 were not discussed in this paper, and the WBSCR19 information is not available from this paper.

AA Sequence

MQKHYTVAWFLYSAPGVDPSPPCRSLGWKRKREWSDESEEEPEKELAPEPEETWVVETLCGLKMKLKQQR      1 - 70
VSPILLEHHKDFNSQLAPGVDPSPPHRSFCWKRKMEWWDKSEESEEEPRKVLAPEPEEIWVAEMLCGLKM     71 - 140
KLKRRRVSLVLPEHHEAFNRLLEDPVIKRFLAWDKDLRVSDKYLLAMVIAYFSRAGFPSWQYQRLHFFLA    141 - 210
LYLANDMEEDDEDSKQNIFHFLYGKNRSRIPLLRKRRFQLYRSMNPRARKNRSHIPLVRKRRFQLRRCMN    211 - 280
PRARKNRSQIVLFQKRRFHFFCSMSCRAWVSPEELEEIQAYDPEHWVWARDRARLS                  281 - 336
//

Text Mined References (4)

PMID Year Title
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15574121 2005 Characterization of a new family of cyclin-dependent kinase activators.
12853948 2003 The DNA sequence of human chromosome 7.
12073013 2002 Identification of additional transcripts in the Williams-Beuren syndrome critical region.