Property Summary

NCBI Gene PubMed Count 11
PubMed Score 3.94
PubTator Score 3.02

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8NFV4 H7BYM8 Q6PJU0 Q8N722 Q8N723 Q8NFV2 Q8NFV3 Q9HBS8
Symbols PP1226
WBSCR21

Gene

PANTHER Protein Class (3)

 GO Function (1)

 GO Component (1)

 Compartment GO Term (0)

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
504498 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inhibitors of LYPLA1: LC-MS/MS assay to assess binding of compounds to active site of anti-target ABHD11
504892 other 1 / 0 / 1 Late stage assay provider results from the probe development effort to identify inhibitors of ABHD11: Fluorescence-based biochemical gel-based Activity-Based Protein Profiling (ABPP) inhibition of the human isoform of ABHD11

Gene RIF (2)

PMID Text
21596165 Abhydrolase domain-containing protein 11 and Esterase D predict the development of distant metastases and the presence of aggressive lung adenocarcinomas.
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MRAGQQLASMLRWTRAWRLPREGLGPHGPSFARVPVAPSSSSGGRGGAEPRPLPLSYRLLDGEAALPAVV      1 - 70
FLHGLFGSKTNFNSIAKILAQQTGRRVLTVDARNHGDSPHSPDMSYEIMSQDLQDLLPQLGLVPCVVVGH     71 - 140
SMGGKTAMLLALQRPELVERLIAVDISPVESTGVSHFATYVAAMRAINIADELPRSRARKLADEQLSSVI    141 - 210
QDMAVRQHLLTNLVEVDGRFVWRVNLDALTQHLDKILAFPQRQESYLGPTLFLLGGNSQFVHPSHHPEIM    211 - 280
RLFPRAQMQTVPNAGHWIHADRPQDFIAAIRGFLV                                       281 - 315
//

Text Mined References (12)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
21596165 2011 Activity-based proteomics: identification of ABHD11 and ESD activities as potential biomarkers for human lung adenocarcinoma.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
17567985 2007 Distinct class of putative "non-conserved" promoters in humans: comparative studies of alternative promoters of human and mouse genes.
16381901 2006 The LIFEdb database in 2006.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...