Property Summary

NCBI Gene PubMed Count 13
PubMed Score 5.74
PubTator Score 3.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

 GO Function (1)

 GO Component (1)

 Compartment GO Term (1)

Gene RIF (4)

AA Sequence

MRAGQQLASMLRWTRAWRLPREGLGPHGPSFARVPVAPSSSSGGRGGAEPRPLPLSYRLLDGEAALPAVV      1 - 70
FLHGLFGSKTNFNSIAKILAQQTGRRVLTVDARNHGDSPHSPDMSYEIMSQDLQDLLPQLGLVPCVVVGH     71 - 140
SMGGKTAMLLALQRPELVERLIAVDISPVESTGVSHFATYVAAMRAINIADELPRSRARKLADEQLSSVI    141 - 210
QDMAVRQHLLTNLVEVDGRFVWRVNLDALTQHLDKILAFPQRQESYLGPTLFLLGGNSQFVHPSHHPEIM    211 - 280
RLFPRAQMQTVPNAGHWIHADRPQDFIAAIRGFLV                                       281 - 315
//

Text Mined References (14)

PMID Year Title