Property Summary

NCBI Gene PubMed Count 14
PubMed Score 17.24
PubTator Score 21.85

Knowledge Summary

Patent (745)

TINX Plot

  Disease (4)

Disease Target Count P-value
psoriasis 6694 7.2e-78
medulloblastoma, large-cell 6241 3.0e-05
cystic fibrosis 1696 3.6e-04
ulcerative colitis 1819 2.5e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Chromosome 19p13.13 deletion syndrome 5 0.0 5.0

Expression

  Differential Expression (4)

Disease log2 FC p
cystic fibrosis -1.500 3.6e-04
medulloblastoma, large-cell 1.100 3.0e-05
psoriasis -2.900 7.2e-78
ulcerative colitis -2.000 2.5e-03

Gene RIF (7)

AA Sequence

MTVTYTARVANARFGGFSQLLLLWRGSIYKLLWRELLCFLGFYMALSAAYRFVLTEGQKRYFEKLVIYCD      1 - 70
QYASLIPVSFVLGFYVTLVVNRWWSQYLCMPLPDALMCVVAGTVHGRDDRGRLYRRTLMRYAGLSAVLIL     71 - 140
RSVSTAVFKRFPTIDHVVEAGFMTREERKKFENLNSSYNKYWVPCVWFSNLAAQARREGRIRDNSALKLL    141 - 210
LEELNVFRGKCGMLFHYDWISVPLVYTQVVTIALYSYFLACLIGRQFLDPAQGYKDHDLDLCVPIFTLLQ    211 - 280
FFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNFQVSMLAVDEMYDDLAVLEKDLYWDAAEARAPYTAA    281 - 350
TVFQLRQPSFQGSTFDITLAKEDMQFQRLDGLDGPMGEAPGDFLQRLLPAGAGMVAGGPLGRRLSFLLRK    351 - 420
NSCVSEASTGASCSCAVVPEGAAPECSCGDPLLDPGLPEPEAPPPAGPEPLTLIPGPVEPFSIVTMPGPR    421 - 490
GPAPPWLPSPIGEEEENLA                                                       491 - 509
//

Text Mined References (15)

PMID Year Title