Property Summary

NCBI Gene PubMed Count 16
PubMed Score 45.59
PubTator Score 1592.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
lung carcinoma 2844 6.32023420791045E-41
cystic fibrosis 1670 7.28557783577577E-10
psoriasis 6685 1.21627578643317E-7
nasopharyngeal carcinoma 1056 1.1401515362489E-5
group 3 medulloblastoma 2254 7.68290014284171E-4
permanent atrial fibrillation 44 0.00289954032246078
atypical teratoid / rhabdoid tumor 4369 0.00784995347040321
medulloblastoma, large-cell 6234 0.00814306891252543
gastric carcinoma 832 0.0134001633371126
adrenocortical carcinoma 1427 0.0373578321062342
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Cerebellar Ataxia 72 3.335 1.7
Anus disease 4 3.163 1.6

Expression

  Differential Expression (10)

Disease log2 FC p
permanent atrial fibrillation -1.400 0.003
group 3 medulloblastoma -2.500 0.001
cystic fibrosis 8.515 0.000
atypical teratoid / rhabdoid tumor -2.600 0.008
medulloblastoma, large-cell -3.500 0.008
adrenocortical carcinoma -1.904 0.037
nasopharyngeal carcinoma -2.300 0.000
psoriasis -2.200 0.000
lung carcinoma 4.000 0.000
gastric carcinoma -3.300 0.013

Synonym

Accession Q8NFT8 A6NP39 Q53R88 Q53TP7 Q53TQ5 Q8IYT0 Q8TB42 Q9NTF1 Q9UDM2
Symbols bet
UNQ26

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid

 CSPA Cell Line (1)

Gene RIF (7)

PMID Text
25300688 DNER rs1861612 C to T change and variant T genotype may contribute to T2DM in a Chinese Han population
24101674 These studies implicate DNER as a susceptibility gene for T2DM in American Indians.
23383108 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 upregulates the expression of delta/notch-like EGF repeat containing (DNER) in peptide-treated PBMCs
20367751 Our data suggest that clathrin-independent endocytosis is critical for the polarized targeting of somatodendritic proteins(DNER).
20237496 Observational study of gene-disease association. (HuGE Navigator)
20070733 The inhibition of DNER protein resulted in an increase in adipocyte maturation, partly via a reduction of cell proliferation through elevation of CCAAT-Enhancer-Binding Protein-delta expression.
11950833 expression in developing and mature central nervous system

AA Sequence

MQPRRAQAPGAQLLPALALLLLLLGAGPRGSSLANPVPAAPLSAPGPCAAQPCRNGGVCTSRPEPDPQHP      1 - 70
APAGEPGYSCTCPAGISGANCQLVADPCASNPCHHGNCSSSSSSSSDGYLCICNEGYEGPNCEQALPSLP     71 - 140
ATGWTESMAPRQLQPVPATQEPDKILPRSQATVTLPTWQPKTGQKVVEMKWDQVEVIPDIACGNASSNSS    141 - 210
AGGRLVSFEVPQNTSVKIRQDATASLILLWKVTATGFQQCSLIDGRSVTPLQASGGLVLLEEMLALGNNH    211 - 280
FIGFVNDSVTKSIVALRLTLVVKVSTCVPGESHANDLECSGKGKCTTKPSEATFSCTCEEQYVGTFCEEY    281 - 350
DACQRKPCQNNASCIDANEKQDGSNFTCVCLPGYTGELCQSKIDYCILDPCRNGATCISSLSGFTCQCPE    351 - 420
GYFGSACEEKVDPCASSPCQNNGTCYVDGVHFTCNCSPGFTGPTCAQLIDFCALSPCAHGTCRSVGTSYK    421 - 490
CLCDPGYHGLYCEEEYNECLSAPCLNAATCRDLVNGYECVCLAEYKGTHCELYKDPCANVSCLNGATCDS    491 - 560
DGLNGTCICAPGFTGEECDIDINECDSNPCHHGGSCLDQPNGYNCHCPHGWVGANCEIHLQWKSGHMAES    561 - 630
LTNMPRHSLYIIIGALCVAFILMLIILIVGICRISRIEYQGSSRPAYEEFYNCRSIDSEFSNAIASIRHA    631 - 700
RFGKKSRPAMYDVSPIAYEDYSPDDKPLVTLIKTKDL                                     701 - 737
//

Text Mined References (18)

PMID Year Title
25300688 2015 Association between single nucleotide polymorphisms of delta/notch-like epidermal growth factor (EGF)-related receptor (DNER) and Delta-like 1 Ligand (DLL 1) with the risk of type 2 diabetes mellitus in a Chinese Han population.
24101674 2014 A genome-wide association study in American Indians implicates DNER as a susceptibility locus for type 2 diabetes.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23284291 2012 Genome-wide joint meta-analysis of SNP and SNP-by-smoking interaction identifies novel loci for pulmonary function.
20367751 2010 Polarized targeting of DNER into dendritic plasma membrane in hippocampal neurons depends on endocytosis.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20070733 2010 DNER modulates adipogenesis of human adipose tissue-derived mesenchymal stem cells via regulation of cell proliferation.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16740002 2006 Identification of N-linked glycoproteins in human saliva by glycoprotein capture and mass spectrometry.
More...