Property Summary

NCBI Gene PubMed Count 20
PubMed Score 49.12
PubTator Score 1592.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adrenocortical carcinoma -1.904 3.7e-02
atypical teratoid / rhabdoid tumor -2.600 7.8e-03
cystic fibrosis 8.515 7.3e-10
gastric carcinoma -3.300 1.3e-02
group 3 medulloblastoma -2.500 7.7e-04
lung carcinoma 4.000 6.3e-41
medulloblastoma, large-cell -3.500 8.1e-03
nasopharyngeal carcinoma -2.300 1.1e-05
permanent atrial fibrillation -1.400 2.9e-03
psoriasis -1.400 8.5e-03

 CSPA Cell Line (1)

Gene RIF (11)

AA Sequence

MQPRRAQAPGAQLLPALALLLLLLGAGPRGSSLANPVPAAPLSAPGPCAAQPCRNGGVCTSRPEPDPQHP      1 - 70
APAGEPGYSCTCPAGISGANCQLVADPCASNPCHHGNCSSSSSSSSDGYLCICNEGYEGPNCEQALPSLP     71 - 140
ATGWTESMAPRQLQPVPATQEPDKILPRSQATVTLPTWQPKTGQKVVEMKWDQVEVIPDIACGNASSNSS    141 - 210
AGGRLVSFEVPQNTSVKIRQDATASLILLWKVTATGFQQCSLIDGRSVTPLQASGGLVLLEEMLALGNNH    211 - 280
FIGFVNDSVTKSIVALRLTLVVKVSTCVPGESHANDLECSGKGKCTTKPSEATFSCTCEEQYVGTFCEEY    281 - 350
DACQRKPCQNNASCIDANEKQDGSNFTCVCLPGYTGELCQSKIDYCILDPCRNGATCISSLSGFTCQCPE    351 - 420
GYFGSACEEKVDPCASSPCQNNGTCYVDGVHFTCNCSPGFTGPTCAQLIDFCALSPCAHGTCRSVGTSYK    421 - 490
CLCDPGYHGLYCEEEYNECLSAPCLNAATCRDLVNGYECVCLAEYKGTHCELYKDPCANVSCLNGATCDS    491 - 560
DGLNGTCICAPGFTGEECDIDINECDSNPCHHGGSCLDQPNGYNCHCPHGWVGANCEIHLQWKSGHMAES    561 - 630
LTNMPRHSLYIIIGALCVAFILMLIILIVGICRISRIEYQGSSRPAYEEFYNCRSIDSEFSNAIASIRHA    631 - 700
RFGKKSRPAMYDVSPIAYEDYSPDDKPLVTLIKTKDL                                     701 - 737
//

Text Mined References (22)

PMID Year Title