Property Summary

NCBI Gene PubMed Count 16
Grant Count 16
R01 Count 6
Funding $1,206,019.64
PubMed Score 45.59
PubTator Score 1592.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
permanent atrial fibrillation -1.400 0.003
group 3 medulloblastoma -2.500 0.001
cystic fibrosis 8.515 0.000
atypical teratoid / rhabdoid tumor -2.600 0.008
medulloblastoma, large-cell -3.500 0.008
adrenocortical carcinoma -1.904 0.037
nasopharyngeal carcinoma -2.300 0.000
psoriasis -2.200 0.000
lung carcinoma 4.000 0.000
gastric carcinoma -3.300 0.013

Gene RIF (7)

PMID Text
25300688 DNER rs1861612 C to T change and variant T genotype may contribute to T2DM in a Chinese Han population
24101674 These studies implicate DNER as a susceptibility gene for T2DM in American Indians.
23383108 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 upregulates the expression of delta/notch-like EGF repeat containing (DNER) in peptide-treated PBMCs
20367751 Our data suggest that clathrin-independent endocytosis is critical for the polarized targeting of somatodendritic proteins(DNER).
20237496 Observational study of gene-disease association. (HuGE Navigator)
20070733 The inhibition of DNER protein resulted in an increase in adipocyte maturation, partly via a reduction of cell proliferation through elevation of CCAAT-Enhancer-Binding Protein-delta expression.
11950833 expression in developing and mature central nervous system

AA Sequence

MQPRRAQAPGAQLLPALALLLLLLGAGPRGSSLANPVPAAPLSAPGPCAAQPCRNGGVCTSRPEPDPQHP      1 - 70
APAGEPGYSCTCPAGISGANCQLVADPCASNPCHHGNCSSSSSSSSDGYLCICNEGYEGPNCEQALPSLP     71 - 140
ATGWTESMAPRQLQPVPATQEPDKILPRSQATVTLPTWQPKTGQKVVEMKWDQVEVIPDIACGNASSNSS    141 - 210
AGGRLVSFEVPQNTSVKIRQDATASLILLWKVTATGFQQCSLIDGRSVTPLQASGGLVLLEEMLALGNNH    211 - 280
FIGFVNDSVTKSIVALRLTLVVKVSTCVPGESHANDLECSGKGKCTTKPSEATFSCTCEEQYVGTFCEEY    281 - 350
DACQRKPCQNNASCIDANEKQDGSNFTCVCLPGYTGELCQSKIDYCILDPCRNGATCISSLSGFTCQCPE    351 - 420
GYFGSACEEKVDPCASSPCQNNGTCYVDGVHFTCNCSPGFTGPTCAQLIDFCALSPCAHGTCRSVGTSYK    421 - 490
CLCDPGYHGLYCEEEYNECLSAPCLNAATCRDLVNGYECVCLAEYKGTHCELYKDPCANVSCLNGATCDS    491 - 560
DGLNGTCICAPGFTGEECDIDINECDSNPCHHGGSCLDQPNGYNCHCPHGWVGANCEIHLQWKSGHMAES    561 - 630
LTNMPRHSLYIIIGALCVAFILMLIILIVGICRISRIEYQGSSRPAYEEFYNCRSIDSEFSNAIASIRHA    631 - 700
RFGKKSRPAMYDVSPIAYEDYSPDDKPLVTLIKTKDL                                     701 - 737
//

Text Mined References (18)

PMID Year Title
25300688 2015 Association between single nucleotide polymorphisms of delta/notch-like epidermal growth factor (EGF)-related receptor (DNER) and Delta-like 1 Ligand (DLL 1) with the risk of type 2 diabetes mellitus in a Chinese Han population.
24101674 2014 A genome-wide association study in American Indians implicates DNER as a susceptibility locus for type 2 diabetes.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23284291 2012 Genome-wide joint meta-analysis of SNP and SNP-by-smoking interaction identifies novel loci for pulmonary function.
20367751 2010 Polarized targeting of DNER into dendritic plasma membrane in hippocampal neurons depends on endocytosis.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20070733 2010 DNER modulates adipogenesis of human adipose tissue-derived mesenchymal stem cells via regulation of cell proliferation.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16740002 2006 Identification of N-linked glycoproteins in human saliva by glycoprotein capture and mass spectrometry.
More...