Property Summary

NCBI Gene PubMed Count 1
PubMed Score 82.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

AA Sequence

MDPCKVNELRAFVKMCKQDPSVLHTEEMRFLREWVESMGGKVPPATQKAKSEENTKEEKPDSKKVEEDLK      1 - 70
ADEPSTEESDLEIDKEGVIEPDTDAPQEMGDENVEITEEMMDQANDKKVAAIEVLNDGELQKAIDLFTDA     71 - 140
IKLNPRLAILYAKRASVFVKLQKPNAAIQDCDRAIEINPDSAQPYKWRGKAHRLLGHWEEAAHDLAFACK    141 - 210
LDYDEDASAMLKEVQPRAQKIAEHWRKYERKHEEREIKERIERVKKAQEEQERAQREEEARRQSGAHYGP    211 - 280
FPGGFPGGMPGNFPGGMPGMGGDMPGMAGMPGLNEILSDPEALAAMQDPEVMVAFQDVAQNPANMSKYQS    281 - 350
NPKVMNLISKLSAKFGGQA                                                       351 - 369
//

Text Mined References (2)

PMID Year Title