Property Summary

NCBI Gene PubMed Count 1
Grant Count 129
R01 Count 97
Funding $10,790,518.8
PubMed Score 75.62

Knowledge Summary

Patent

No data available

Synonym

Accession Q8NFI4
Symbols FAM10A5

Gene

AA Sequence

MDPCKVNELRAFVKMCKQDPSVLHTEEMRFLREWVESMGGKVPPATQKAKSEENTKEEKPDSKKVEEDLK      1 - 70
ADEPSTEESDLEIDKEGVIEPDTDAPQEMGDENVEITEEMMDQANDKKVAAIEVLNDGELQKAIDLFTDA     71 - 140
IKLNPRLAILYAKRASVFVKLQKPNAAIQDCDRAIEINPDSAQPYKWRGKAHRLLGHWEEAAHDLAFACK    141 - 210
LDYDEDASAMLKEVQPRAQKIAEHWRKYERKHEEREIKERIERVKKAQEEQERAQREEEARRQSGAHYGP    211 - 280
FPGGFPGGMPGNFPGGMPGMGGDMPGMAGMPGLNEILSDPEALAAMQDPEVMVAFQDVAQNPANMSKYQS    281 - 350
NPKVMNLISKLSAKFGGQA                                                       351 - 369
//

Text Mined References (2)

PMID Year Title
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
12079276 2002 Characterization of FAM10A4, a member of the ST13 tumor suppressor gene family that maps to the 13q14.3 region associated with B-Cell leukemia, multiple myeloma, and prostate cancer.