Property Summary

NCBI Gene PubMed Count 10
PubMed Score 10.16
PubTator Score 8.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
posterior fossa group B ependymoma 416 9.5e-07
osteosarcoma 7950 1.6e-06
psoriasis 6694 1.5e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Cryptorchidism 296 4.002 2.0
Situs Inversus 65 3.763 1.9
Male infertility 206 3.24 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.477 1.6e-06
posterior fossa group B ependymoma 1.700 9.5e-07
psoriasis -1.500 1.5e-05

Gene RIF (7)

AA Sequence

MAAAGQEKGYLTQTAAALDKSPSLSPQLAAPIRGRPKKCLVYPHAPKSSRLSRSVLRWLQGLDLSFFPRN      1 - 70
INRDFSNGFLIAEIFCIYYPWELELSSFENGTSLKVKLDNWAQLEKFLARKKFKLPKELIHGTIHCKAGV     71 - 140
PEILIEEVYTLLTHREIKSIQDDFVNFTDYSYQMRLPLVSRSTVSKSIKDNIRLSELLSNPNMLTNELKA    141 - 210
EFLILLHMLQRKLGRKLNPEWFDVKPTVGEVTLNHLPAQASGRRYNLKVKRGRVVPVLPNIGSGGSSHRE    211 - 280
IHVKQAGQHSYYSAMKPIRNMDKKP                                                 281 - 305
//

Text Mined References (10)

PMID Year Title