Property Summary

NCBI Gene PubMed Count 10
PubMed Score 10.71
PubTator Score 8.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.477 0.000
posterior fossa group B ependymoma 1.700 0.000
psoriasis -1.500 0.000

Synonym

Accession Q8NEY3 Q8NCS5 Q8WW15
Symbols SPEF1B
TSARG2

Gene

 GO Component (1)

 Compartment GO Term (1)

Gene RIF (7)

PMID Text
26424010 SPATA4 protects HeLa cells against etoposide-induced apoptosis through the mitochondrial apoptotic pathway, providing further evidence that SPATA4 plays a role in regulating apoptosis
21827752 Results suggest a role for SPATA4 in membrane traffic and a specialized function for TRAPP in spermatocytes.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18976975 Knockdown of spermatogenesis associated 4 (SPATA4) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
16336790 analysis of SPATA4 expression and variation in promotor sequences
15158438 TSARG2 may play an important role in the development of cryptorchid testis and be a testis-specific apoptosis candidate oncogene
12019456 expressed in many tissues and mapped to chromosome 4q33-34.1 by database analyses

AA Sequence

MAAAGQEKGYLTQTAAALDKSPSLSPQLAAPIRGRPKKCLVYPHAPKSSRLSRSVLRWLQGLDLSFFPRN      1 - 70
INRDFSNGFLIAEIFCIYYPWELELSSFENGTSLKVKLDNWAQLEKFLARKKFKLPKELIHGTIHCKAGV     71 - 140
PEILIEEVYTLLTHREIKSIQDDFVNFTDYSYQMRLPLVSRSTVSKSIKDNIRLSELLSNPNMLTNELKA    141 - 210
EFLILLHMLQRKLGRKLNPEWFDVKPTVGEVTLNHLPAQASGRRYNLKVKRGRVVPVLPNIGSGGSSHRE    211 - 280
IHVKQAGQHSYYSAMKPIRNMDKKP                                                 281 - 305
//

Text Mined References (10)

PMID Year Title
26424010 2015 SPATA4 Counteracts Etoposide-Induced Apoptosis via Modulating Bcl-2 Family Proteins in HeLa Cells.
25416956 2014 A proteome-scale map of the human interactome network.
21827752 2011 A yeast two hybrid screen identifies SPATA4 as a TRAPP interactor.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16336790 2005 Molecular cloning and bioinformatic analysis of SPATA4 gene.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15158438 2004 Cloning of a full-length cDNA of human testis-specific spermatogenic cell apoptosis inhibitor TSARG2 as a candidate oncogene.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12019456 2002 [Rapid identification of human testis spermatocyte apoptosis-related gene, TSARG2, by nested PCR and draft human genome searching].