Property Summary

NCBI Gene PubMed Count 18
PubMed Score 370.04
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

Synonym

Accession Q8NEV1 CK II alpha 3
Symbols CSNK2A1P

Gene

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

Gene RIF (1)

PMID Text
20625391 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKIL      1 - 70
KPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTDFKQLYQTLTDYDIRFYMYEI     71 - 140
LKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDYQMYD    141 - 210
YSLDMWRLGCMLASMIFRKEPFFHGRDNYDQLVRIAKFLGTEDLYGYIDKYNIELDPRFNDILGRHSRKR    211 - 280
WERFVHSENQHLVSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMGSSSMPGGSTPVSSAN    281 - 350
VMSGISSVPTPSPLGPLAGSPVIAAANPLGMPVPAATGAQQ                                 351 - 391
//

Text Mined References (19)

PMID Year Title
20625391 2010 Functional polymorphism of the CK2alpha intronless gene plays oncogenic roles in lung cancer.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15684395 2005 Activation of pre-mRNA splicing by human RNPS1 is regulated by CK2 phosphorylation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14646071 2003 Three-dimensional atomic structure of a catalytic subunit mutant of human protein kinase CK2.
12860116 2003 Crystal structure of a C-terminal deletion mutant of human protein kinase CK2 catalytic subunit.
12393879 2002 p53 serine 392 phosphorylation increases after UV through induction of the assembly of the CK2.hSPT16.SSRP1 complex.
12102635 2002 Sequencing of full-length cDNA encoding the alpha and beta subunits of human casein kinase II from human platelets and megakaryocytic cells. Expression of the casein kinase IIalpha intronless gene in a megakaryocytic cell line.
11239457 2001 A DNA damage-induced p53 serine 392 kinase complex contains CK2, hSpt16, and SSRP1.
11181995 2001 The sequence of the human genome.
More...