Property Summary

NCBI Gene PubMed Count 18
PubMed Score 377.73
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Hemolytic anemia 77 0.0 3.0
Disease Target Count Z-score Confidence
Intellectual disability 1016 0.0 4.0

Expression

 GO Component (1)

Gene RIF (1)

AA Sequence

MSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKIL      1 - 70
KPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTDFKQLYQTLTDYDIRFYMYEI     71 - 140
LKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDYQMYD    141 - 210
YSLDMWRLGCMLASMIFRKEPFFHGRDNYDQLVRIAKFLGTEDLYGYIDKYNIELDPRFNDILGRHSRKR    211 - 280
WERFVHSENQHLVSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMGSSSMPGGSTPVSSAN    281 - 350
VMSGISSVPTPSPLGPLAGSPVIAAANPLGMPVPAATGAQQ                                 351 - 391
//

Text Mined References (19)

PMID Year Title