Property Summary

NCBI Gene PubMed Count 12
Grant Count 38
R01 Count 28
Funding $1,792,083.35
PubMed Score 121.62
PubTator Score 8.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
tuberculosis and treatment for 6 months 1.200 0.000
colon cancer -1.700 0.046
diabetes mellitus -1.100 0.001
group 3 medulloblastoma 1.100 0.016
ovarian cancer -2.800 0.000

 GO Function (1)

Gene RIF (3)

PMID Text
25887473 the results of this study in vitro confirmed that NGDN over-expression can increase the sensitivity of human myeloid multidrug-resistant leukemia cells to chemotherapeutic drugs
22727665 poly(A) polymerase Gld2, deadenylase PARN, and translation inhibitory factor neuroguidin (Ngd) are components of a dendritic CPEB-associated polyadenylation apparatus
18547334 Study isolated a novel human gene, to be called as CANu1, by the large-scale genome-wide association analysis to screen specific Single nucleotide polymorphisms in colon cancer.

AA Sequence

MAALGVLESDLPSAVTLLKNLQEQVMAVTAQVKSLTQKVQAGAYPTEKGLSFLEVKDQLLLMYLMDLTHL      1 - 70
ILDKASGGSLQGHDAVLRLVEIRTVLEKLRPLDQKLKYQIDKLIKTAVTGSLSENDPLRFKPHPSNMMSK     71 - 140
LSSEDEEEDEAEDDQSEASGKKSVKGVSKKYVPPRLVPVHYDETEAEREKKRLERAKRRALSSSVIRELK    141 - 210
EQYSDAPEEIRDARHPHVTRQSQEDQHRINYEESMMVRLSVSKREKGRRKRANVMSSQLHSLTHFSDISA    211 - 280
LTGGTVHLDEDQNPIKKRKKIPQKGRKKKGFRRRR                                       281 - 315
//

Text Mined References (18)

PMID Year Title
25887473 2015 High expression of neuroguidin increases the sensitivity of acute myeloid leukemia cells to chemotherapeutic drugs.
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22727665 2012 Bidirectional control of mRNA translation and synaptic plasticity by the cytoplasmic polyadenylation complex.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...