Property Summary

NCBI Gene PubMed Count 12
PubMed Score 133.14
PubTator Score 8.16

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Heart disease 306 0.0 3.0
Disease Target Count Z-score Confidence
Gaucher's disease 26 3.477 1.7
Cancer 2499 3.005 1.5

Expression

  Differential Expression (5)

Disease log2 FC p
colon cancer -1.700 4.6e-02
diabetes mellitus -1.100 1.4e-03
group 3 medulloblastoma 1.100 1.6e-02
ovarian cancer -1.100 8.5e-07
tuberculosis and treatment for 6 months 1.200 1.1e-04

 GO Function (1)

Gene RIF (3)

AA Sequence

MAALGVLESDLPSAVTLLKNLQEQVMAVTAQVKSLTQKVQAGAYPTEKGLSFLEVKDQLLLMYLMDLTHL      1 - 70
ILDKASGGSLQGHDAVLRLVEIRTVLEKLRPLDQKLKYQIDKLIKTAVTGSLSENDPLRFKPHPSNMMSK     71 - 140
LSSEDEEEDEAEDDQSEASGKKSVKGVSKKYVPPRLVPVHYDETEAEREKKRLERAKRRALSSSVIRELK    141 - 210
EQYSDAPEEIRDARHPHVTRQSQEDQHRINYEESMMVRLSVSKREKGRRKRANVMSSQLHSLTHFSDISA    211 - 280
LTGGTVHLDEDQNPIKKRKKIPQKGRKKKGFRRRR                                       281 - 315
//

Text Mined References (18)

PMID Year Title