Property Summary

NCBI Gene PubMed Count 12
PubMed Score 121.62
PubTator Score 8.16

Knowledge Summary


No data available


  Disease Sources (3)

Disease Target Count P-value
ovarian cancer 8492 3.42587757734463E-7
tuberculosis and treatment for 6 months 686 1.0954074878921E-4
diabetes mellitus 1663 0.00139373707069883
group 3 medulloblastoma 2254 0.0161717175773992
colon cancer 1475 0.0460246400742683
Disease Target Count Z-score Confidence
Heart disease 279 0.0 2.0
Disease Target Count Z-score Confidence
Gaucher's disease 25 3.279 1.6


  Differential Expression (5)

Disease log2 FC p
tuberculosis and treatment for 6 months 1.200 0.000
colon cancer -1.700 0.046
diabetes mellitus -1.100 0.001
group 3 medulloblastoma 1.100 0.016
ovarian cancer -2.800 0.000


Accession Q8NEJ9 A8K760 Q9Y400
Symbols NGD


  Ortholog (14)

 GO Function (1)

Pathway (1)

Gene RIF (3)

25887473 the results of this study in vitro confirmed that NGDN over-expression can increase the sensitivity of human myeloid multidrug-resistant leukemia cells to chemotherapeutic drugs
22727665 poly(A) polymerase Gld2, deadenylase PARN, and translation inhibitory factor neuroguidin (Ngd) are components of a dendritic CPEB-associated polyadenylation apparatus
18547334 Study isolated a novel human gene, to be called as CANu1, by the large-scale genome-wide association analysis to screen specific Single nucleotide polymorphisms in colon cancer.

AA Sequence

LTGGTVHLDEDQNPIKKRKKIPQKGRKKKGFRRRR                                       281 - 315

Text Mined References (18)

PMID Year Title
25887473 2015 High expression of neuroguidin increases the sensitivity of acute myeloid leukemia cells to chemotherapeutic drugs.
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22727665 2012 Bidirectional control of mRNA translation and synaptic plasticity by the cytoplasmic polyadenylation complex.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.