Property Summary

NCBI Gene PubMed Count 10
PubMed Score 14.21
PubTator Score 8.15

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

PMID Text
23333304 HIV-1 Vif downregulates the expression of meiosis-specific nuclear structural 1 (MNS1) in Vif-expression T cells
15942958 A rat homologous protein was among the the nuclear proteins that change in abundance or form in response to prolonged hypoxia in the rat kidney fibroblasts.
8032679 Cloning and functional characterization of a highly similar gene in mouse.

AA Sequence

MGSKRRNLSCSERHQKLVDENYCKKLHVQALKNVNSQIRNQMVQNENDNRVQRKQFLRLLQNEQFELDME      1 - 70
EAIQKAEENKRLKELQLKQEEKLAMELAKLKHESLKDEKMRQQVRENSIELRELEKKLKAAYMNKERAAQ     71 - 140
IAEKDAIKYEQMKRDAEIAKTMMEEHKRIIKEENAAEDKRNKAKAQYYLDLEKQLEEQEKKKQEAYEQLL    141 - 210
KEKLMIDEIVRKIYEEDQLEKQQKLEKMNAMRRYIEEFQKEQALWRKKKREEMEEENRKIIEFANMQQQR    211 - 280
EEDRMAKVQENEEKRLQLQNALTQKLEEMLRQREDLEQVRQELYQEEQAEIYKSKLKEEAEKKLRKQKEM    281 - 350
KQDFEEQMALKELVLQAAKEEEENFRKTMLAKFAEDDRIELMNAQKQRMKQLEHRRAVEKLIEERRQQFL    351 - 420
ADKQRELEEWQLQQRRQGFINAIIEEERLKLLKEHATNLLGYLPKGVFKKEDDIDLLGEEFRKVYQQRSE    421 - 490
ICEEK                                                                     491 - 495
//

Text Mined References (11)

PMID Year Title
25187353 2014 Clozapine-induced agranulocytosis is associated with rare HLA-DQB1 and HLA-B alleles.
24068947 2013 Common variants in left/right asymmetry genes and pathways are associated with relative hand skill.
23770605 2013 Genome-wide association study identifies multiple risk loci for chronic lymphocytic leukemia.
22396656 2012 MNS1 is essential for spermiogenesis and motile ciliary functions in mice.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15942958 2005 Proteomics profiling of nuclear proteins for kidney fibroblasts suggests hypoxia, meiosis, and cancer may meet in the nucleus.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8032679 1994 cDNA cloning and functional characterization of a meiosis-specific protein (MNS1) with apparent nuclear association.
More...