Property Summary

NCBI Gene PubMed Count 10
PubMed Score 14.10
PubTator Score 8.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.400 8.5e-03
Breast cancer -1.300 2.7e-03
chronic rhinosinusitis -1.904 2.8e-02
ependymoma 3.100 1.3e-13
glioblastoma 1.200 6.4e-03
group 3 medulloblastoma 1.600 4.3e-02
malignant mesothelioma 1.100 6.7e-04
nasopharyngeal carcinoma -1.400 9.7e-03
non diabetic and post-ischemic heart fai... 1.300 3.9e-03
ovarian cancer 1.900 2.5e-05
pediatric high grade glioma 1.200 1.2e-02
type II diabetes mellitus and post-ische... 1.100 3.2e-02

Synonym

Accession Q8NEH6 Q8IYT6 Q9NUP4
Symbols SPATA40

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Gene RIF (3)

AA Sequence

MGSKRRNLSCSERHQKLVDENYCKKLHVQALKNVNSQIRNQMVQNENDNRVQRKQFLRLLQNEQFELDME      1 - 70
EAIQKAEENKRLKELQLKQEEKLAMELAKLKHESLKDEKMRQQVRENSIELRELEKKLKAAYMNKERAAQ     71 - 140
IAEKDAIKYEQMKRDAEIAKTMMEEHKRIIKEENAAEDKRNKAKAQYYLDLEKQLEEQEKKKQEAYEQLL    141 - 210
KEKLMIDEIVRKIYEEDQLEKQQKLEKMNAMRRYIEEFQKEQALWRKKKREEMEEENRKIIEFANMQQQR    211 - 280
EEDRMAKVQENEEKRLQLQNALTQKLEEMLRQREDLEQVRQELYQEEQAEIYKSKLKEEAEKKLRKQKEM    281 - 350
KQDFEEQMALKELVLQAAKEEEENFRKTMLAKFAEDDRIELMNAQKQRMKQLEHRRAVEKLIEERRQQFL    351 - 420
ADKQRELEEWQLQQRRQGFINAIIEEERLKLLKEHATNLLGYLPKGVFKKEDDIDLLGEEFRKVYQQRSE    421 - 490
ICEEK                                                                     491 - 495
//

Text Mined References (11)

PMID Year Title