Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent (307)

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 7.7e-10
osteosarcoma 7950 6.6e-04

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.034 6.6e-04
ovarian cancer 1.100 7.7e-10

 Compartment GO Term (0)

Gene RIF (1)

AA Sequence

MLGPGSNRRRPTQGERGPGSPGEPMEKYQVLYQLNPGALGVNLVVEEMETKVKHVIKQVECMDDHYASQA      1 - 70
LEELMPLLKLRHAHISVYQELFITWNGEISSLYLCLVMEFNELSFQEVIEDKRKAKKIIDSEWMQNVLGQ     71 - 140
VLDALEYLHHLDIIHRNLKPSNIILISSDHCKLQDLSSNVLMTDKAKWNIRAEEDPFRKSWMAPEALNFS    141 - 210
FSQKSDIWSLGCIILDMTSCSFMDGTEAMHLRKSLRQSPGSLKAVLKTMEEKQIPDVETFRNLLPLMLQI    211 - 280
DPSDRITIKDVVHITFLRGSFKSSCVSLTLHRQMVPASITDMLLEGNVASILEVMQKFSGWPEVQLRAMK    281 - 350
RLLKMPADQLGLPWPPELVEVVVTTMELHDRVLDVQLCACSLLLHLLGQALVHHPEAKAPCNQAITSTLL    351 - 420
SALQSHPEEEPLLVMVYSLLAITTTQESESLSEELQNAGLLEHILEHLNSSLKSRDVCASGLGLLWALLL    421 - 490
DGIIVNKAPLEKVPDLISQVLATYPADGEMAEASCGVFWLLSLLGCIKEQQFEQVVALLLQSIRLCQDRA    491 - 560
LLVNNAYRGLASLVKVSELAAFKVVVQEEGGSGLSLIKETYQLHRDDPEVVENVGMLLVHLASYEEILPE    561 - 630
LVSSSMKALLQEIKERFTSSLVSDSSAFSKPGLPPGGSPQLGCTTSGGLE                        631 - 680
//

Text Mined References (7)

PMID Year Title