Property Summary

NCBI Gene PubMed Count 7
PubMed Score 4.34
PubTator Score 2.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Infertility, Male 46 0.0 0.0
Disease Target Count
Male infertility 206
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Infertility 188 3.579 1.8

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma 1.700 8.0e-06
Astrocytoma, Pilocytic 1.400 7.4e-06
atypical teratoid / rhabdoid tumor 2.900 5.6e-04
Breast cancer -1.600 1.1e-05
chronic rhinosinusitis -2.397 7.1e-03
ependymoma 2.200 4.2e-08
glioblastoma 1.500 5.5e-06
group 4 medulloblastoma 1.400 1.7e-06
interstitial cystitis -1.400 4.5e-03
lung carcinoma 1.300 4.1e-07
nasopharyngeal carcinoma -1.200 1.3e-02
osteosarcoma -1.737 8.1e-05
primitive neuroectodermal tumor 1.600 1.3e-03
spina bifida -1.438 4.2e-02

Gene RIF (3)

AA Sequence

MLNSTGELEFSNEEDPEIISQLTSLPLSGGKSSAGVPEKTGYPDSVYVMAANIFQGIRIEKSAQKVLIKY      1 - 70
GNEPLRSLSESEDQSFQRLSYELAFSALKYQDILETILIDSCIFPSTTIPDHLSSLIIVMLYDFQDRKFQ     71 - 140
TRVLSDNEEPISEVQEVENLLNSFKIKLAAALARCRIKHDALSIYHILPETVRKQELRASTLPLYAWINT    141 - 210
CKISPEEVYNNLKRRGYNKVKSVLHIDDKVFAVDQHCYDVLIFPSHLKNDLINIDLFKDYKLIFQDKSRS    211 - 280
LAVHSVKALLNMDDDVLMVNTGSWYTVSHMSILTNNNTSKVFVCGVQSQAKDPDLKTLFTKIGCKNIEIL    281 - 350
HEKFINIESKDHRLQKVKVILLLPRCSGLGVSNPVEFILNEHEDTEFLKDHSQGGISVDKLHVLAQQQYE    351 - 420
QLTHAMKFTKAQAVVYCTCSVFPEENEAVVKKALEFQDLGNKGQPYRLSPPVLPLCSLKEIQLSTDKFFR    421 - 490
MEPSEITNGCFLSILTRERDPSETVSVNDVLARAAAKGLLDGIELGKSSKREKKKKKSKTSLTKGATTDN    491 - 560
GIQMKIAEFLNRETKASANLSETVTKPPLPQKNTAQVGASSQTRKPNKLAPHPAVPAFVKNTCPSRPRER    561 - 630
QTHFLRPRPEDRMVALKPIKIVLPPVFMPFSSPQGIRSRMPTQHLYCRWVAPKALVPTCLPTHSLSRKEE    631 - 700
KPKDDTPSSLLRPPRRWL                                                        701 - 718
//

Text Mined References (9)

PMID Year Title