Property Summary

NCBI Gene PubMed Count 6
PubMed Score 4.34
PubTator Score 2.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
osteosarcoma -1.737 0.000
posterior fossa group B ependymoma 3.000 0.000
glioblastoma 1.600 0.001
atypical teratoid / rhabdoid tumor 2.900 0.001
primitive neuroectodermal tumor 1.600 0.001
interstitial cystitis -1.500 0.001
adult high grade glioma 1.700 0.000
group 4 medulloblastoma 1.400 0.000
pilocytic astrocytoma 1.400 0.000
nasopharyngeal carcinoma -1.200 0.013
lung carcinoma 1.300 0.000
spina bifida -1.438 0.042
Breast cancer -1.600 0.000
chronic rhinosinusitis -2.397 0.007

Gene RIF (2)

PMID Text
26345859 Our findings revealed that genetic polymorphisms in exon7 of the NSUN7 gene are not associated with asthenospermia in Chinese Han men.
25702163 Nsun7 (A11337)-deletion mutation, causes reduction of its protein rate and associated with sperm motility defect in infertile men.

AA Sequence

MLNSTGELEFSNEEDPEIISQLTSLPLSGGKSSAGVPEKTGYPDSVYVMAANIFQGIRIEKSAQKVLIKY      1 - 70
GNEPLRSLSESEDQSFQRLSYELAFSALKYQDILETILIDSCIFPSTTIPDHLSSLIIVMLYDFQDRKFQ     71 - 140
TRVLSDNEEPISEVQEVENLLNSFKIKLAAALARCRIKHDALSIYHILPETVRKQELRASTLPLYAWINT    141 - 210
CKISPEEVYNNLKRRGYNKVKSVLHIDDKVFAVDQHCYDVLIFPSHLKNDLINIDLFKDYKLIFQDKSRS    211 - 280
LAVHSVKALLNMDDDVLMVNTGSWYTVSHMSILTNNNTSKVFVCGVQSQAKDPDLKTLFTKIGCKNIEIL    281 - 350
HEKFINIESKDHRLQKVKVILLLPRCSGLGVSNPVEFILNEHEDTEFLKDHSQGGISVDKLHVLAQQQYE    351 - 420
QLTHAMKFTKAQAVVYCTCSVFPEENEAVVKKALEFQDLGNKGQPYRLSPPVLPLCSLKEIQLSTDKFFR    421 - 490
MEPSEITNGCFLSILTRERDPSETVSVNDVLARAAAKGLLDGIELGKSSKREKKKKKSKTSLTKGATTDN    491 - 560
GIQMKIAEFLNRETKASANLSETVTKPPLPQKNTAQVGASSQTRKPNKLAPHPAVPAFVKNTCPSRPRER    561 - 630
QTHFLRPRPEDRMVALKPIKIVLPPVFMPFSSPQGIRSRMPTQHLYCRWVAPKALVPTCLPTHSLSRKEE    631 - 700
KPKDDTPSSLLRPPRRWL                                                        701 - 718
//

Text Mined References (8)

PMID Year Title
26345859 2015 Investigation of polymorphisms in exon7 of the NSUN7 gene among Chinese Han men with asthenospermia.
25702163 2015 The Nsun7 (A11337)-deletion mutation, causes reduction of its protein rate and associated with sperm motility defect in infertile men.
17442852 2007 Sperm motility defects and infertility in male mice with a mutation in Nsun7, a member of the Sun domain-containing family of putative RNA methyltransferases.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.