Property Summary

NCBI Gene PubMed Count 18
PubMed Score 475.40
PubTator Score 15.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 8.46820220363542E-7
ovarian cancer 8492 5.10986024796614E-6
cystic fibrosis 1670 5.12155503606174E-4
medulloblastoma, large-cell 6234 5.92140899686606E-4
psoriasis 6685 9.9957550934607E-4
tuberculosis and treatment for 6 months 686 0.00357476259174717
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.015312006378384
Breast cancer 3099 0.0279373531095706

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis -1.100 0.001
osteosarcoma -1.969 0.000
cystic fibrosis 1.005 0.001
medulloblastoma, large-cell -1.700 0.001
tuberculosis and treatment for 6 months 1.400 0.004
intraductal papillary-mucinous neoplasm ... 1.100 0.015
Breast cancer 2.500 0.028
ovarian cancer -1.500 0.000

Synonym

Accession Q8NDX5 A2RRP9 Q5HYF0 Q6NSG2 Q8NFT7 Q8NFZ1 Q8TBM2 Q9H971 Q9H9I4
Symbols EDR3
HPH3

Gene

PDB

4PZN   4PZO  

  Ortholog (9)

Gene RIF (5)

PMID Text
26343356 Data show that polycomb-group proteins BMI1, PHC3, CBX6 and CBX7 expression was significantly increased during imatinib treatment.
23942079 PHC3 amplification may emerge as a biomarker in cancer.
22724443 SAM linker controls PHC3 SAM polymerization
20491773 PHC3 is a tumor suppressor in osteosarcoma cells abd its suppression may be caused by modification of polycomb repressive complex 1 in cancer cells.
17001316 loss of PHC3 may favor tumorigenesis by potentially disrupting the ability of cells to remain in G(0)

AA Sequence

MDTEPNPGTSSVSTTTSSTTTTTITTSSSRMQQPQISVYSGSDRHAVQVIQQALHRPPSSAAQYLQQMYA      1 - 70
AQQQHLMLHTAALQQQHLSSSQLQSLAAVQASLSSGRPSTSPTGSVTQQSSMSQTSINLSTSPTPAQLIS     71 - 140
RSQASSSTSGSITQQTMLLGSTSPTLTASQAQMYLRAQMLIFTPATTVAAVQSDIPVVSSSSSSSCQSAA    141 - 210
TQVQNLTLRSQKLGVLSSSQNGPPKSTSQTQSLTICHNKTTVTSSKISQRDPSPESNKKGESPSLESRST    211 - 280
AVTRTSSIHQLIAPASYSPIQPHSLIKHQQIPLHSPPSKVSHHQLILQQQQQQIQPITLQNSTQDPPPSQ    281 - 350
HCIPLQNHGLPPAPSNAQSQHCSPIQSHPSPLTVSPNQSQSAQQSVVVSPPPPHSPSQSPTIIIHPQALI    351 - 420
QPHPLVSSALQPGPNLQQSTANQVQATAQLNLPSHLPLPASPVVHIGPVQQSALVSPGQQIVSPSHQQYS    421 - 490
SLQSSPIPIASPPQMSTSPPAQIPPLPLQSMQSLQVQPEILSQGQVLVQNALVSEEELPAAEALVQLPFQ    491 - 560
TLPPPQTVAVNLQVQPPAPVDPPVVYQVEDVCEEEMPEESDECVRMDRTPPPPTLSPAAITVGRGEDLTS    561 - 630
EHPLLEQVELPAVASVSASVIKSPSDPSHVSVPPPPLLLPAATTRSNSTSMHSSIPSIENKPPQAIVKPQ    631 - 700
ILTHVIEGFVIQEGLEPFPVSRSSLLIEQPVKKRPLLDNQVINSVCVQPELQNNTKHADNSSDTEMEDMI    701 - 770
AEETLEEMDSELLKCEFCGKMGYANEFLRSKRFCTMSCAKRYNVSCSKKFALSRWNRKPDNQSLGHRGRR    771 - 840
PSGPDGAAREHILRQLPITYPSAEEDLASHEDSVPSAMTTRLRRQSERERERELRDVRIRKMPENSDLLP    841 - 910
VAQTEPSIWTVDDVWAFIHSLPGCQDIADEFRAQEIDGQALLLLKEDHLMSAMNIKLGPALKICARINSL    911 - 980
KES                                                                       981 - 983
//

Text Mined References (27)

PMID Year Title
26343356 2015 Polycomb genes are associated with response to imatinib in chronic myeloid leukemia.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23942079 2013 Mutational analysis of Polycomb genes in solid tumours identifies PHC3 amplification as a possible cancer-driving genetic alteration.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22724443 2012 Human polyhomeotic homolog 3 (PHC3) sterile alpha motif (SAM) linker allows open-ended polymerization of PHC3 SAM.
21282530 2011 Interaction proteomics analysis of polycomb proteins defines distinct PRC1 complexes in mammalian cells.
20491773 2010 Polycomb group molecule PHC3 regulates polycomb complex composition and prognosis of osteosarcoma.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
More...