Property Summary

NCBI Gene PubMed Count 18
PubMed Score 526.73
PubTator Score 15.73

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
Breast cancer 2.500 2.8e-02
cystic fibrosis 1.005 5.1e-04
intraductal papillary-mucinous neoplasm ... 1.100 1.5e-02
medulloblastoma, large-cell -1.700 5.9e-04
osteosarcoma 1.416 1.4e-04
ovarian cancer -1.500 5.1e-06
psoriasis -1.100 1.0e-03
tuberculosis and treatment for 6 months 1.400 3.6e-03

Protein-protein Interaction (4)

Gene RIF (5)

AA Sequence

MDTEPNPGTSSVSTTTSSTTTTTITTSSSRMQQPQISVYSGSDRHAVQVIQQALHRPPSSAAQYLQQMYA      1 - 70
AQQQHLMLHTAALQQQHLSSSQLQSLAAVQASLSSGRPSTSPTGSVTQQSSMSQTSINLSTSPTPAQLIS     71 - 140
RSQASSSTSGSITQQTMLLGSTSPTLTASQAQMYLRAQMLIFTPATTVAAVQSDIPVVSSSSSSSCQSAA    141 - 210
TQVQNLTLRSQKLGVLSSSQNGPPKSTSQTQSLTICHNKTTVTSSKISQRDPSPESNKKGESPSLESRST    211 - 280
AVTRTSSIHQLIAPASYSPIQPHSLIKHQQIPLHSPPSKVSHHQLILQQQQQQIQPITLQNSTQDPPPSQ    281 - 350
HCIPLQNHGLPPAPSNAQSQHCSPIQSHPSPLTVSPNQSQSAQQSVVVSPPPPHSPSQSPTIIIHPQALI    351 - 420
QPHPLVSSALQPGPNLQQSTANQVQATAQLNLPSHLPLPASPVVHIGPVQQSALVSPGQQIVSPSHQQYS    421 - 490
SLQSSPIPIASPPQMSTSPPAQIPPLPLQSMQSLQVQPEILSQGQVLVQNALVSEEELPAAEALVQLPFQ    491 - 560
TLPPPQTVAVNLQVQPPAPVDPPVVYQVEDVCEEEMPEESDECVRMDRTPPPPTLSPAAITVGRGEDLTS    561 - 630
EHPLLEQVELPAVASVSASVIKSPSDPSHVSVPPPPLLLPAATTRSNSTSMHSSIPSIENKPPQAIVKPQ    631 - 700
ILTHVIEGFVIQEGLEPFPVSRSSLLIEQPVKKRPLLDNQVINSVCVQPELQNNTKHADNSSDTEMEDMI    701 - 770
AEETLEEMDSELLKCEFCGKMGYANEFLRSKRFCTMSCAKRYNVSCSKKFALSRWNRKPDNQSLGHRGRR    771 - 840
PSGPDGAAREHILRQLPITYPSAEEDLASHEDSVPSAMTTRLRRQSERERERELRDVRIRKMPENSDLLP    841 - 910
VAQTEPSIWTVDDVWAFIHSLPGCQDIADEFRAQEIDGQALLLLKEDHLMSAMNIKLGPALKICARINSL    911 - 980
KES                                                                       981 - 983
//

Text Mined References (28)

PMID Year Title