Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 1.43864982950112E-24
ovarian cancer 8492 1.00118808593761E-4
Pick disease 1893 1.93819811200947E-4
atypical teratoid / rhabdoid tumor 4369 2.56115543035053E-4
medulloblastoma, large-cell 6234 3.10008019294164E-4
glioblastoma 5572 5.41842174669148E-4
pediatric high grade glioma 2712 0.00267981343243973
osteosarcoma 7933 0.00377547088921645
chronic rhinosinusitis 512 0.00648646752797998
ependymoma 2514 0.0142765308620983
progressive supranuclear palsy 674 0.0230522811469341
cystic fibrosis and chronic rhinosinusitis 213 0.0301095796754542
Disease Target Count Z-score Confidence
Male infertility 170 3.258 1.6

Expression

  Differential Expression (12)

Disease log2 FC p
ependymoma 1.100 0.014
osteosarcoma -1.442 0.004
atypical teratoid / rhabdoid tumor -1.400 0.000
glioblastoma -1.900 0.001
medulloblastoma, large-cell -2.100 0.000
pediatric high grade glioma -1.300 0.003
lung carcinoma 2.300 0.000
Pick disease -1.400 0.000
progressive supranuclear palsy -1.100 0.023
ovarian cancer -1.500 0.000
chronic rhinosinusitis -1.498 0.006
cystic fibrosis and chronic rhinosinusit... -1.084 0.030

Synonym

Accession Q8NDH6 B3KRW6 Q53P45 Q53QZ4 Q53T97 Q96N47 Q96Q32 Q9BVQ2
Symbols ALS2CR14
ALS2CR15

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Pig OMA Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Zebrafish EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MDSFGQPRPEDNQSVVRRMQKKYWKTKQVFIKATGKKEDEHLVASDAELDAKLEVFHSVQETCTELLKII      1 - 70
EKYQLRLNVISEEENELGLFLKFQAERDATQAGKMMDATGKALCSSAKQRLALCTPLSRLKQEVATFSQR     71 - 140
AVSDTLMTINRMEQARTEYRGALLWMKDVSQELDPDTLKQMEKFRKVQMQVRNSKASFDKLKMDVCQKVD    141 - 210
LLGASRCNMLSHSLTTYQRTLLGFWKKTARMMSQIHEACIGFHPYDFVALKQLQDTPSKISEDNKDEQIG    211 - 280
GFLTEQLNKLVLSDEEASFESEQANKDHNEKHSQMREFGAPQFSNSENVAKDLPVDSLEGEDFEKEFSFL    281 - 350
NNLLSSGSSSTSEFTQECQTAFGSPSASLTSQEPSMGSEPLAHSSRFLPSQLFDLGFHVAGAFNNWVSQE    351 - 420
ESELCLSHTDNQPVPSQSPKKLTRSPNNGNQDMSAWFNLFADLDPLSNPDAIGHSDDELLNA            421 - 482
//

Text Mined References (9)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11586298 2001 A gene encoding a putative GTPase regulator is mutated in familial amyotrophic lateral sclerosis 2.