Property Summary

NCBI Gene PubMed Count 11
PubMed Score 42.48
PubTator Score 10.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
posterior fossa group A ependymoma 1511 1.56938303667471E-16
juvenile dermatomyositis 1189 1.533904747259E-8
acute quadriplegic myopathy 1157 1.23207592019051E-7
tuberculosis 1563 3.44963799271454E-7
Amyotrophic Lateral Sclerosis 432 4.52795418779323E-7
pilocytic astrocytoma 3086 1.12900793269344E-6
group 4 medulloblastoma 1875 1.22447976485931E-5
pediatric high grade glioma 2712 1.77266279242219E-5
atypical teratoid / rhabdoid tumor 4369 2.5528720859062E-5
ovarian cancer 8492 3.66887829071515E-5
psoriasis 6685 4.96368804475227E-4
dermatomyositis 967 0.00105464055658922
astrocytoma 1493 0.00354078846005435
Disease Target Count Z-score Confidence
Chronic inflammatory demyelinating polyradiculoneuropathy 5 4.029 2.0

Expression

  Differential Expression (13)

Disease log2 FC p
psoriasis -1.200 0.000
posterior fossa group A ependymoma 1.800 0.000
astrocytoma 1.700 0.004
atypical teratoid / rhabdoid tumor 1.300 0.000
group 4 medulloblastoma 1.200 0.000
juvenile dermatomyositis 1.067 0.000
acute quadriplegic myopathy 1.568 0.000
Amyotrophic Lateral Sclerosis 1.132 0.000
tuberculosis -1.100 0.000
pediatric high grade glioma 1.100 0.000
pilocytic astrocytoma 1.100 0.000
ovarian cancer 1.900 0.000
dermatomyositis 1.700 0.001

Synonym

Accession Q8NDC0 B2RDD8 Q96BG5
Symbols MISS
C14orf32
c14_5346

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid

AA Sequence

MSDEFSLADALPEHSPAKTSAVSNTKPGQPPQGWPGSNPWNNPSAPSSVPSGLPPSATPSTVPFGPAPTG      1 - 70
MYPSVPPTGPPPGPPAPFPPSGPSCPPPGGPYPAPTVPGPGPTGPYPTPNMPFPELPRPYGAPTDPAAAG     71 - 140
PLGPWGSMSSGPWAPGMGGQYPTPNMPYPSPGPYPAPPPPQAPGAAPPVPWGTVPPGAWGPPAPYPAPTG    141 - 210
SYPTPGLYPTPSNPFQVPSGPSGAPPMPGGPHSYH                                       211 - 245
//

Text Mined References (17)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
More...