Property Summary

NCBI Gene PubMed Count 13
PubMed Score 50.48
PubTator Score 10.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
acute quadriplegic myopathy 1.162 6.5e-04
Amyotrophic lateral sclerosis 1.132 4.5e-07
astrocytoma 1.600 1.6e-03
Astrocytoma, Pilocytic 1.100 6.4e-07
atypical teratoid / rhabdoid tumor 1.300 2.6e-05
dermatomyositis 1.700 1.1e-03
ependymoma 1.200 8.8e-12
group 4 medulloblastoma 1.200 1.2e-05
juvenile dermatomyositis 1.067 1.5e-08
ovarian cancer -1.700 1.4e-05
pediatric high grade glioma 1.100 1.8e-05
psoriasis -1.200 5.0e-04
tuberculosis -1.100 3.4e-07

Synonym

Accession Q8NDC0 B2RDD8 Q96BG5
Symbols MISS
C14orf32
c14_5346

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG Inparanoid

AA Sequence

MSDEFSLADALPEHSPAKTSAVSNTKPGQPPQGWPGSNPWNNPSAPSSVPSGLPPSATPSTVPFGPAPTG      1 - 70
MYPSVPPTGPPPGPPAPFPPSGPSCPPPGGPYPAPTVPGPGPTGPYPTPNMPFPELPRPYGAPTDPAAAG     71 - 140
PLGPWGSMSSGPWAPGMGGQYPTPNMPYPSPGPYPAPPPPQAPGAAPPVPWGTVPPGAWGPPAPYPAPTG    141 - 210
SYPTPGLYPTPSNPFQVPSGPSGAPPMPGGPHSYH                                       211 - 245
//

Text Mined References (19)

PMID Year Title