Property Summary

NCBI Gene PubMed Count 11
Grant Count 8
R01 Count 7
Funding $2,249,257.5
PubMed Score 42.48
PubTator Score 10.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
psoriasis -1.200 0.000
posterior fossa group A ependymoma 1.800 0.000
astrocytoma 1.700 0.004
atypical teratoid / rhabdoid tumor 1.300 0.000
group 4 medulloblastoma 1.200 0.000
juvenile dermatomyositis 1.067 0.000
acute quadriplegic myopathy 1.568 0.000
Amyotrophic Lateral Sclerosis 1.132 0.000
tuberculosis -1.100 0.000
pediatric high grade glioma 1.100 0.000
pilocytic astrocytoma 1.100 0.000
ovarian cancer 1.900 0.000
dermatomyositis 1.700 0.001

AA Sequence

MSDEFSLADALPEHSPAKTSAVSNTKPGQPPQGWPGSNPWNNPSAPSSVPSGLPPSATPSTVPFGPAPTG      1 - 70
MYPSVPPTGPPPGPPAPFPPSGPSCPPPGGPYPAPTVPGPGPTGPYPTPNMPFPELPRPYGAPTDPAAAG     71 - 140
PLGPWGSMSSGPWAPGMGGQYPTPNMPYPSPGPYPAPPPPQAPGAAPPVPWGTVPPGAWGPPAPYPAPTG    141 - 210
SYPTPGLYPTPSNPFQVPSGPSGAPPMPGGPHSYH                                       211 - 245
//

Text Mined References (17)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
More...