Property Summary

NCBI Gene PubMed Count 14
PubMed Score 11.97
PubTator Score 65.26

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8ND90 A8K4L5 O95144 Q8NG07
Symbols MA1

Gene

PANTHER Protein Class (1)

Gene RIF (2)

PMID Text
27003254 PNMA2 functions as antagonist of MOAP-1 and PNMA1 through heterodimeric interaction
25120759 this study provides evidence that PNMA1 is involved in tumor growth of pancreatic carcinoma

AA Sequence

MAMTLLEDWCRGMDVNSQRALLVWGIPVNCDEAEIEETLQAAMPQVSYRMLGRMFWREENAKAALLELTG      1 - 70
AVDYAAIPREMPGKGGVWKVLFKPPTSDAEFLERLHLFLAREGWTVQDVARVLGFQNPTPTPGPEMPAEM     71 - 140
LNYILDNVIQPLVESIWYKRLTLFSGRDIPGPGEETFDPWLEHTNEVLEEWQVSDVEKRRRLMESLRGPA    141 - 210
ADVIRILKSNNPAITTAECLKALEQVFGSVESSRDAQIKFLNTYQNPGEKLSAYVIRLEPLLQKVVEKGA    211 - 280
IDKDNVNQARLEQVIAGANHSGAIRRQLWLTGAGEGPAPNLFQLLVQIREEEAKEEEEEAEATLLQLGLE    281 - 350
GHF                                                                       351 - 353
//

Text Mined References (17)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
27003254 2016 PNMA2 mediates heterodimeric interactions and antagonizes chemo-sensitizing activities mediated by members of PNMA family.
25416956 2014 A proteome-scale map of the human interactome network.
25120759 2014 PNMA1 promotes cell growth in human pancreatic ductal adenocarcinoma.
21516116 2011 Next-generation sequencing to generate interactome datasets.
19366867 2009 Paraneoplastic antigen-like 5 gene (PNMA5) is preferentially expressed in the association areas in a primate specific manner.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16214224 2005 The human PNMA family: novel neuronal proteins implicated in paraneoplastic neurological disease.
More...