Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.21
PubTator Score 2.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Polycystic ovary syndrome 360 0.0 0.0
Disease Target Count P-value
psoriasis 6694 2.6e-24
glioblastoma 5792 1.3e-04
adult high grade glioma 3801 2.3e-04
non primary Sjogren syndrome sicca 891 1.7e-02
pancreatic cancer 2398 3.6e-02
spina bifida 1074 3.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Disease Target Count Z-score Confidence
Spinal stenosis 19 3.966 2.0

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma -1.400 2.3e-04
glioblastoma -1.200 1.3e-04
non primary Sjogren syndrome sicca 1.300 1.7e-02
pancreatic cancer -1.300 3.6e-02
psoriasis 1.100 2.6e-24
spina bifida 1.135 3.6e-02

Gene RIF (1)

AA Sequence

MAKPSVELTRELQDSIRRCLSQGAVLQQHHVKLETKPKKFEDRVLALTSWRLHLFLLKVPAKVESSFNVL      1 - 70
EIRAFNTLSQNQILVETERGMVSMRLPSAESVDQVTRHVSSALSKVCPGPGCLIRRGNADTPEGPRDTSP     71 - 140
NSETSTSTTHSVCGGFSETYAALCDYNGLHCREEVQWDVDTIYHAEDNREFNLLDFSHLESRDLALMVAA    141 - 210
LAYNQWFTKLYCKDLRLGSEVLEQVLHTLSKSGSLEELVLDNAGLKTDFVQKLAGVFGENGSCVLHALTL    211 - 280
SHNPIEDKGFLSLSQQLLCFPSGLTKLCLAKTAISPRGLQALGQTFGANPAFASSLRYLDLSKNPGLLAT    281 - 350
DEANALYSFLAQPNALVHLDLSGTDCVIDLLLGALLHGCCSHLTYLNLARNSCSHRKGREAPPAFKQFFS    351 - 420
SAYTLSHVNLSATKLPLEALRALLQGLSLNSHLSDLHLDLSSCELRSAGAQALQEQLGAVTCVGSLDLSD    421 - 490
NGFDSDLLTLVPALGKNKSLKHLFLGKNFNVKAKTLEEILHKLVQLIQEEDCSLQSLSVADSRLKLRTSI    491 - 560
LINALGSNTCLAKVDLSGNGMEDIGAKMLSKALQINSSLRTILWDRNNTSALGFLDIARALESNHTLRFM    561 - 630
SFPVSDISQAYRSAPERTEDVWQKIQWCLVRNNHSQTCPQEQAFRLQQGLVTSSAEQMLQRLCGRVQEEV    631 - 700
RALRLCPLEPVQDELLYARDLIKDAKNSRALFPSLYELGHVLANDGPVRQRLESVASEVSKAVDKELQVI    701 - 770
LESMVSLTQELCPVAMRVAEGHNKMLSNVAERVTVPRNFIRGALLEQAGQDIQNKLDEVKLSVVTYLTSS    771 - 840
IVDEILQELYHSHKSLARHLTQLRTLSDPPGCPGQGQDLSSRGRGRNHDHEETTDDELGTNIDTMAIKKQ    841 - 910
KRCRKIRPVSAFISGSPQDMESQLGNLGIPPGWFSGLGGSQPTASGSWEGLSELPTHGYKLRHQTQGRPR    911 - 980
PPRTTPPGPGRPSMPAPGTRQENGMATRLDEGLEDFFSRRVLEESSSYPRTLRTVRPGLSEAPLPPLQKK    981 - 1050
RRRGLFHFRRPRSFKGDRGPGSPTTGLLLPPPPPPPPTQESPPSPDPPSLGNNSSPCWSPEEESSLLPGF   1051 - 1120
GGGRGPSFRRKMGTEGSEPGEGGPAPGTAQQPRVHGVALPGLERAKGWSFDGKREGPGPDQEGSTQAWQK   1121 - 1190
RRSSDDAGPGSWKPPPPPQSTKPSFSAMRRAEATWHIAEESAPNHSCQSPSPASQDGEEEKEGTLFPERT   1191 - 1260
LPARNAKLQDPALAPWPPKPVAVPRGRQPPQEPGVREEAEAGDAAPGVNKPRLRLSSQQDQEEPEVQGPP   1261 - 1330
DPGRRTAPLKPKRTRRAQSCDKLEPDRRRPPDPTGTSEPGTD                               1331 - 1372
//

Text Mined References (11)

PMID Year Title