Property Summary

NCBI Gene PubMed Count 7
Grant Count 6
R01 Count 4
Funding $306,056.39
PubMed Score 3.14
PubTator Score 2.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
glioblastoma -1.200 0.000
adult high grade glioma -1.400 0.000
non primary Sjogren syndrome sicca 1.300 0.017
spina bifida 1.135 0.036
pancreatic cancer -1.300 0.036
psoriasis 1.100 0.000

Gene RIF (1)

PMID Text
21102520 a novel oncofetal-like gene, LRRC16B, was indentified.

AA Sequence

MAKPSVELTRELQDSIRRCLSQGAVLQQHHVKLETKPKKFEDRVLALTSWRLHLFLLKVPAKVESSFNVL      1 - 70
EIRAFNTLSQNQILVETERGMVSMRLPSAESVDQVTRHVSSALSKVCPGPGCLIRRGNADTPEGPRDTSP     71 - 140
NSETSTSTTHSVCGGFSETYAALCDYNGLHCREEVQWDVDTIYHAEDNREFNLLDFSHLESRDLALMVAA    141 - 210
LAYNQWFTKLYCKDLRLGSEVLEQVLHTLSKSGSLEELVLDNAGLKTDFVQKLAGVFGENGSCVLHALTL    211 - 280
SHNPIEDKGFLSLSQQLLCFPSGLTKLCLAKTAISPRGLQALGQTFGANPAFASSLRYLDLSKNPGLLAT    281 - 350
DEANALYSFLAQPNALVHLDLSGTDCVIDLLLGALLHGCCSHLTYLNLARNSCSHRKGREAPPAFKQFFS    351 - 420
SAYTLSHVNLSATKLPLEALRALLQGLSLNSHLSDLHLDLSSCELRSAGAQALQEQLGAVTCVGSLDLSD    421 - 490
NGFDSDLLTLVPALGKNKSLKHLFLGKNFNVKAKTLEEILHKLVQLIQEEDCSLQSLSVADSRLKLRTSI    491 - 560
LINALGSNTCLAKVDLSGNGMEDIGAKMLSKALQINSSLRTILWDRNNTSALGFLDIARALESNHTLRFM    561 - 630
SFPVSDISQAYRSAPERTEDVWQKIQWCLVRNNHSQTCPQEQAFRLQQGLVTSSAEQMLQRLCGRVQEEV    631 - 700
RALRLCPLEPVQDELLYARDLIKDAKNSRALFPSLYELGHVLANDGPVRQRLESVASEVSKAVDKELQVI    701 - 770
LESMVSLTQELCPVAMRVAEGHNKMLSNVAERVTVPRNFIRGALLEQAGQDIQNKLDEVKLSVVTYLTSS    771 - 840
IVDEILQELYHSHKSLARHLTQLRTLSDPPGCPGQGQDLSSRGRGRNHDHEETTDDELGTNIDTMAIKKQ    841 - 910
KRCRKIRPVSAFISGSPQDMESQLGNLGIPPGWFSGLGGSQPTASGSWEGLSELPTHGYKLRHQTQGRPR    911 - 980
PPRTTPPGPGRPSMPAPGTRQENGMATRLDEGLEDFFSRRVLEESSSYPRTLRTVRPGLSEAPLPPLQKK    981 - 1050
RRRGLFHFRRPRSFKGDRGPGSPTTGLLLPPPPPPPPTQESPPSPDPPSLGNNSSPCWSPEEESSLLPGF   1051 - 1120
GGGRGPSFRRKMGTEGSEPGEGGPAPGTAQQPRVHGVALPGLERAKGWSFDGKREGPGPDQEGSTQAWQK   1121 - 1190
RRSSDDAGPGSWKPPPPPQSTKPSFSAMRRAEATWHIAEESAPNHSCQSPSPASQDGEEEKEGTLFPERT   1191 - 1260
LPARNAKLQDPALAPWPPKPVAVPRGRQPPQEPGVREEAEAGDAAPGVNKPRLRLSSQQDQEEPEVQGPP   1261 - 1330
DPGRRTAPLKPKRTRRAQSCDKLEPDRRRPPDPTGTSEPGTD                               1331 - 1372
//

Text Mined References (11)

PMID Year Title
26578515 2016 Cell Migration and Invadopodia Formation Require a Membrane-binding Domain of CARMIL2.
21102520 2011 Identifying LRRC16B as an oncofetal gene with transforming enhancing capability using a combined bioinformatics and experimental approach.
19846667 2009 Distinct roles for CARMIL isoforms in cell migration.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15028280 2004 Bridging expressed sequence alignments through targeted cDNA sequencing.
12693554 2003 Characterization of long cDNA clones from human adult spleen. II. The complete sequences of 81 cDNA clones.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...