Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.89
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Polycystic Ovary Syndrome 335
Disease Target Count P-value
juvenile dermatomyositis 1189 1.69975041640328E-12
posterior fossa group B ependymoma 1530 4.27240754559432E-12
nasopharyngeal carcinoma 1056 7.85294730958864E-8
malignant mesothelioma 3163 7.86809038076134E-7
medulloblastoma, large-cell 6234 1.46994190060929E-5
atypical teratoid / rhabdoid tumor 4369 3.18362927327971E-5
glioblastoma 5572 5.57025889047832E-5
adult high grade glioma 2148 2.50045433558763E-4
group 4 medulloblastoma 1875 0.00318745554202212
non primary Sjogren syndrome sicca 840 0.0128464456307274

Expression

Synonym

Accession Q8ND07 Q0P604 Q9H5P8
Symbols CCDC176
C14orf45

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG
Pig OMA EggNOG
Platypus OMA EggNOG
Anole lizard OMA EggNOG
Xenopus OMA EggNOG
Zebrafish OMA EggNOG

AA Sequence

MPSKGKDKKKGKSKGKDTKKLIKTDESVVDRAKANASLWEARLEVTELSRIKYRDTSRILAKSNEDLKKK      1 - 70
QCKMEKDIMSVLSYLKKQDQEKDNMIEKLKQQLNETKEKAQEEKDKLEQKYTRQINELEGQFHQKAKEIG     71 - 140
MIHTELKAVRQFQKRKIQVERELDDLKENLRNTERIHQETLRRLESRFFEEKHRLEQEAEKKIIMLAERA    141 - 210
HHEAIVQLNDAGRNVFKENDYLQKALAYHLKETDALQKNSQKLQESHTLLLHQKEINDLLVKEKIMQLVQ    211 - 280
QRSQIQTLQKKVVNLETALSYMTKEFESEVLKLQQHAMIENQAGQVEIDKLQHLLQMKDREMNRVKKLAK    281 - 350
NILDERTEVERFFLDALHQVKQQILISRKHYKQIAQAAFNLKMRAACTGRTEYPKIRTFDGREHSTNSVN    351 - 420
QDLLEAEKWTHIEGNVDIGDLTWEQKEKVLRLLFAKMNGCPSRKYNQSSRPPVPDYVVSDSGETKEFGDE    421 - 490
SKLQDKIFITQQIAISDSSGEVVLPTIPKEPQESDTGTF                                   491 - 529
//

Text Mined References (8)

PMID Year Title
23900544 2013 Bbof1 is required to maintain cilia orientation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.