Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.89
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.600 2.5e-04
atypical teratoid / rhabdoid tumor -1.400 3.2e-05
ependymoma 1.800 8.2e-09
glioblastoma -1.600 5.6e-05
group 4 medulloblastoma -1.200 3.2e-03
juvenile dermatomyositis -1.047 1.7e-12
malignant mesothelioma -2.100 7.9e-07
medulloblastoma, large-cell -1.600 1.5e-05
nasopharyngeal carcinoma -1.900 7.9e-08
non primary Sjogren syndrome sicca 1.400 1.3e-02

Synonym

Accession Q8ND07 Q0P604 Q9H5P8
Symbols CCDC176
C14orf45

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MPSKGKDKKKGKSKGKDTKKLIKTDESVVDRAKANASLWEARLEVTELSRIKYRDTSRILAKSNEDLKKK      1 - 70
QCKMEKDIMSVLSYLKKQDQEKDNMIEKLKQQLNETKEKAQEEKDKLEQKYTRQINELEGQFHQKAKEIG     71 - 140
MIHTELKAVRQFQKRKIQVERELDDLKENLRNTERIHQETLRRLESRFFEEKHRLEQEAEKKIIMLAERA    141 - 210
HHEAIVQLNDAGRNVFKENDYLQKALAYHLKETDALQKNSQKLQESHTLLLHQKEINDLLVKEKIMQLVQ    211 - 280
QRSQIQTLQKKVVNLETALSYMTKEFESEVLKLQQHAMIENQAGQVEIDKLQHLLQMKDREMNRVKKLAK    281 - 350
NILDERTEVERFFLDALHQVKQQILISRKHYKQIAQAAFNLKMRAACTGRTEYPKIRTFDGREHSTNSVN    351 - 420
QDLLEAEKWTHIEGNVDIGDLTWEQKEKVLRLLFAKMNGCPSRKYNQSSRPPVPDYVVSDSGETKEFGDE    421 - 490
SKLQDKIFITQQIAISDSSGEVVLPTIPKEPQESDTGTF                                   491 - 529
//

Text Mined References (8)

PMID Year Title