Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.67
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Gene RIF (3)

AA Sequence

MPTTKKTLMFLSSFFTSLGSFIVICSILGTQAWITSTIAVRDSASNGSIFITYGLFRGESSEELSHGLAE      1 - 70
PKKKFAVLEILNNSSQKTLHSVTILFLVLSLITSLLSSGFTFYNSISNPYQTFLGPTGVYTWNGLGASFV     71 - 140
FVTMILFVANTQSNQLSEELFQMLYPATTSKGTTHSYGYSFWLILLVILLNIVTVTIIIFYQKARYQRKQ    141 - 210
EQRKPMEYAPRDGILF                                                          211 - 226
//

Text Mined References (14)

PMID Year Title