Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.26
PubTator Score 2.34

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
16718364 This present work as the first report about the functional exploration of the novel ZBTB34 gene would be contributed to profound understanding of the transcriptional regulation via BTB/POZ protein family.

AA Sequence

MDSSSFIQFDVPEYSSTVLSQLNELRLQGKLCDIIVHIQGQPFRAHKAVLAASSPYFRDHSALSTMSGLS      1 - 70
ISVIKNPNVFEQLLSFCYTGRMSLQLKDVVSFLTAASFLQMQCVIDKCTQILESIHSKISVGDVDSVTVG     71 - 140
AEENPESRNGVKDSSFFANPVEISPPYCSQGRQPTASSDLRMETTPSKALRSRLQEEGHSDRGSSGSVSE    141 - 210
YEIQIEGDHEQGDLLVRESQITEVKVKMEKSDRPSCSDSSSLGDDGYHTEMVDGEQVVAVNVGSYGSVLQ    211 - 280
HAYSYSQAASQPTNVSEAFGSLSNSSPSRSMLSCFRGGRARQKRALSVHLHSDLQGLVQGSDSEAMMNNP    281 - 350
GYESSPRERSARGHWYPYNERLICIYCGKSFNQKGSLDRHMRLHMGITPFVCKFCGKKYTRKDQLEYHIR    351 - 420
GHTDDKPFRCEICGKCFPFQGTLNQHLRKNHPGVAEVRSRIESPERTDVYVEQKLENDASASEMGLDSRM    421 - 490
EIHTVSDAPD                                                                491 - 500
//

Text Mined References (7)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16718364 2006 ZBTB34, a novel human BTB/POZ zinc finger protein, is a potential transcriptional repressor.
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12056414 2002 Characterization of size-fractionated cDNA libraries generated by the in vitro recombination-assisted method.