Zinc finger and BTB domain-containing protein 34

Property Summary

NCBI Gene PubMed Count	5
PubMed Score	1.26

PubTator Score	2.34

Knowledge Summary

Patent

No data available

TINX Plot

Disease (2)

Expression Atlas
JensenLab Experiment COSMIC

Disease	Target Count	P-value
chronic lymphosyte leukemia	204	1.6e-05
acute myeloid leukemia	783	2.1e-03
intraductal papillary-mucinous neoplasm (IPMN)	3291	1.1e-02
subependymal giant cell astrocytoma	2287	4.4e-02

Disease	Target Count	Z-score	Confidence
Carcinoma	11493	0.0	0.6

Differential Expression (4)

Disease	log2 FC	p
acute myeloid leukemia	1.500	2.1e-03
chronic lymphosyte leukemia	1.100	1.6e-05
intraductal papillary-mucinous neoplasm ...	1.400	1.1e-02
subependymal giant cell astrocytoma	-1.214	4.4e-02

Spleen 17,614

Lung 18,057

Brain - Cerebellar Hemisphere 18,015

Brain - Cerebellum 17,983

Nerve - Tibial 18,007

Cells - Transformed fibroblasts 17,577

Uterus 17,618

Thyroid 18,024

Cells - EBV-transformed lymphocytes 18,186

Adipose - Visceral (Omentum) 17,937

Pituitary 18,147

Artery - Coronary 17,949

Ovary 17,971

Vagina 17,834

Small Intestine - Terminal Ileum 17,954

Adipose - Subcutaneous 18,110

Prostate 18,213

Skin - Sun Exposed (Lower leg) 17,968

Testis 18,518

Esophagus - Gastroesophageal Junction 18,000

Colon - Sigmoid 18,089

Artery - Aorta 17,896

Brain - Spinal cord (cervical c-1) 17,973

Breast - Mammary Tissue 18,103

Esophagus - Muscularis 18,017

Skin - Not Sun Exposed (Suprapubic) 18,081

Esophagus - Mucosa 18,076

Colon - Transverse 17,825

Minor Salivary Gland 18,005

Artery - Tibial 17,631

Stomach 17,879

Adrenal Gland 18,071

Whole Blood 17,439

Brain - Frontal Cortex (BA9) 18,069

Brain - Nucleus accumbens (basal ganglia... 18,024

Brain - Cortex 18,039

Brain - Substantia nigra 17,981

Brain - Hypothalamus 18,169

Brain - Caudate (basal ganglia) 18,001

Brain - Anterior cingulate cortex (BA24) 17,989

Brain - Putamen (basal ganglia) 17,863

Kidney - Cortex 17,329

Pancreas 18,123

Brain - Hippocampus 18,011

Heart - Atrial Appendage 17,896

Brain - Amygdala 18,006

Liver 18,071

Muscle - Skeletal 17,778

Heart - Left Ventricle 18,006

Adult Spinal Cord 7,594

adipose tissue 15,837

adrenal gland 15,963

appendix 16,247

bone marrow 14,571

breast 16,063

cerebral cortex 16,630

cervix, uterine 15,871

colon 15,959

duodenum 15,975

endometrium 16,349

epididymis 15,863

esophagus 15,898

fallopian tube 16,245

gallbladder 16,333

heart muscle 14,972

kidney 15,917

liver 14,587

lung 16,312

lymph node 15,833

ovary 15,408

pancreas 14,070

parathyroid gland 14,769

placenta 15,937

prostate 16,460

rectum 15,705

salivary gland 14,981

seminal vesicle 15,918

skeletal muscle 14,011

skin 16,206

small intestine 16,154

smooth muscle 15,857

spleen 15,972

stomach 16,099

testis 17,936

thyroid gland 15,959

tonsil 15,400

urinary bladder 15,814

Liver and Pancreas 16,750

Digestive Tract 17,369

Urinary Tract 16,678

Endocrine System 18,159

Blood and immune system 16,909

Respiratory system 16,393

Female tissues 17,400

Male tissues 17,142

Skin and soft tissues 17,230

Nervous System 16,725

Cardiovascular System 15,192

Brain 7,346

Cervical carcinoma cell 4,944

Erythroleukemia cell 4,300

See source...

Synonym

Accession	Q8NCN2 Q38IA7 Q5VYE9
Symbols	ZNF918

Gene

ZBTB34

Ortholog (11)

Species	Source	Disease
Zebrafish 9,725	Inparanoid OMA EggNOG
Mouse 16,567	Inparanoid OMA EggNOG
Rat 15,112	Inparanoid OMA EggNOG
Cow 15,316	Inparanoid OMA EggNOG
Opossum 12,223	Inparanoid EggNOG
Dog 15,069	Inparanoid OMA EggNOG
Horse 14,249	Inparanoid OMA EggNOG
Anole lizard 10,585	Inparanoid OMA EggNOG
Xenopus 10,463	Inparanoid OMA EggNOG
Platypus 5,699	OMA EggNOG
Chicken 7,823	Inparanoid OMA EggNOG

UniProt Keyword (13)

Complete proteome 20,231

DNA-binding 2,008

Metal-binding 3,672

Nucleus 5,259

Reference proteome 20,231

Repeat 4,916

Transcription 2,402

Transcription regulation 2,336

Zinc 2,356

Zinc-finger 1,785

See all...

GO Function (2)

DNA binding 1,481

metal ion binding 2,256

GO Component (1)

nucleoplasm 2,996

GO Process (2)

regulation of transcription, DNA-templat... 1,135

transcription, DNA-templated 1,742

Compartment GO Term (18)

Cell 16,178

Cell part 16,177

Intracellular 14,108

Intracellular membrane-bounded organelle 10,341

Intracellular organelle 12,025

Intracellular organelle lumen 5,090

Intracellular organelle part 8,784

Intracellular part 13,972

Nuclear lumen 3,968

Nuclear part 4,290

Nucleoplasm 5,077

Nucleus 7,562

Organelle 12,238

Organelle lumen 5,090

Organelle part 8,976

See all...

HCA RNA Cell Line (56)

A-431 16,131

A549 15,174

AF22 16,160

AN3-CA 15,648

ASC TERT1 14,842

BEWO 16,726

BJ 15,448

BJ hTERT+ 15,353

BJ hTERT+ SV40 Large T+ 15,609

BJ hTERT+ SV40 Large T+ RasG12V 15,493

See all...

Gene RIF (1)

AA Sequence

MDSSSFIQFDVPEYSSTVLSQLNELRLQGKLCDIIVHIQGQPFRAHKAVLAASSPYFRDHSALSTMSGLS      1 - 70
ISVIKNPNVFEQLLSFCYTGRMSLQLKDVVSFLTAASFLQMQCVIDKCTQILESIHSKISVGDVDSVTVG     71 - 140
AEENPESRNGVKDSSFFANPVEISPPYCSQGRQPTASSDLRMETTPSKALRSRLQEEGHSDRGSSGSVSE    141 - 210
YEIQIEGDHEQGDLLVRESQITEVKVKMEKSDRPSCSDSSSLGDDGYHTEMVDGEQVVAVNVGSYGSVLQ    211 - 280
HAYSYSQAASQPTNVSEAFGSLSNSSPSRSMLSCFRGGRARQKRALSVHLHSDLQGLVQGSDSEAMMNNP    281 - 350
GYESSPRERSARGHWYPYNERLICIYCGKSFNQKGSLDRHMRLHMGITPFVCKFCGKKYTRKDQLEYHIR    351 - 420
GHTDDKPFRCEICGKCFPFQGTLNQHLRKNHPGVAEVRSRIESPERTDVYVEQKLENDASASEMGLDSRM    421 - 490
EIHTVSDAPD                                                                491 - 500
//

Text Mined References (8)

Summary
Details

	PMID	Year	Title

Tdark Zinc finger and BTB domain-containing protein 34 Add to cart View Collections Empty Collection

Property Summary

Knowledge Summary

Patent

No data available

TINX Plot

Disease (2)

Expression

Differential Expression (4)

Synonym

Gene

Ortholog (11)

UniProt Keyword (13)

GO Function (2)

GO Component (1)

GO Process (2)

Compartment GO Term (18)

HCA RNA Cell Line (56)

Gene RIF (1)

AA Sequence

Text Mined References (8)

Tdark Zinc finger and BTB domain-containing protein 34

Add to cart

View Collections

Empty Collection