Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.26
PubTator Score 2.34

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Gene RIF (1)

AA Sequence

MDSSSFIQFDVPEYSSTVLSQLNELRLQGKLCDIIVHIQGQPFRAHKAVLAASSPYFRDHSALSTMSGLS      1 - 70
ISVIKNPNVFEQLLSFCYTGRMSLQLKDVVSFLTAASFLQMQCVIDKCTQILESIHSKISVGDVDSVTVG     71 - 140
AEENPESRNGVKDSSFFANPVEISPPYCSQGRQPTASSDLRMETTPSKALRSRLQEEGHSDRGSSGSVSE    141 - 210
YEIQIEGDHEQGDLLVRESQITEVKVKMEKSDRPSCSDSSSLGDDGYHTEMVDGEQVVAVNVGSYGSVLQ    211 - 280
HAYSYSQAASQPTNVSEAFGSLSNSSPSRSMLSCFRGGRARQKRALSVHLHSDLQGLVQGSDSEAMMNNP    281 - 350
GYESSPRERSARGHWYPYNERLICIYCGKSFNQKGSLDRHMRLHMGITPFVCKFCGKKYTRKDQLEYHIR    351 - 420
GHTDDKPFRCEICGKCFPFQGTLNQHLRKNHPGVAEVRSRIESPERTDVYVEQKLENDASASEMGLDSRM    421 - 490
EIHTVSDAPD                                                                491 - 500
//

Text Mined References (8)

PMID Year Title