Property Summary

NCBI Gene PubMed Count 9
PubMed Score 24.96
PubTator Score 13.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
acute quadriplegic myopathy 1.028 2.9e-04
aldosterone-producing adenoma -1.024 1.9e-02
astrocytoma 1.200 6.3e-03
Breast cancer 1.400 1.6e-20
intraductal papillary-mucinous carcinoma... 1.200 1.7e-03
intraductal papillary-mucinous neoplasm ... 1.500 3.9e-03
juvenile dermatomyositis 1.154 1.0e-09
medulloblastoma, large-cell -1.100 2.4e-03
oligodendroglioma 1.300 7.0e-03
osteosarcoma -1.370 3.2e-06
ovarian cancer -2.100 2.9e-09
pancreatic ductal adenocarcinoma liver m... 1.149 6.7e-03
psoriasis -1.600 1.2e-04

Gene RIF (1)

AA Sequence

MAEPVGKRGRWSGGSGAGRGGRGGWGGRGRRPRAQRSPSRGTLDVVSVDLVTDSDEEILEVATARGAADE      1 - 70
VEVEPPEPPGPVASRDNSNSDSEGEDRRPAGPPREPVRRRRRLVLDPGEAPLVPVYSGKVKSSLRLIPDD     71 - 140
LSLLKLYPPGDEEEAELADSSGLYHEGSPSPGSPWKTKLRTKDKEEKKKTEFLDLDNSPLSPPSPRTKSR    141 - 210
THTRALKKLSEVNKRLQDLRSCLSPKPPQGQEQQGQEDEVVLVEGPTLPETPRLFPLKIRCRADLVRLPL    211 - 280
RMSEPLQSVVDHMATHLGVSPSRILLLFGETELSPTATPRTLKLGVADIIDCVVLTSSPEATETSQQLQL    281 - 350
RVQGKEKHQTLEVSLSRDSPLKTLMSHYEEAMGLSGRKLSFFFDGTKLSGRELPADLGMESGDLIEVWG     351 - 419
//

Text Mined References (16)

PMID Year Title