Property Summary

NCBI Gene PubMed Count 13
PubMed Score 10.22
PubTator Score 7.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Myopathies, Structural, Congenital 15 0.0 0.0
Disease Target Count P-value
diabetes mellitus 1728 1.9e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count
Myopathy, Centronuclear, 1 3

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus -1.100 1.9e-03

 GWAS Trait (1)

Protein-protein Interaction (3)

Gene RIF (5)

AA Sequence

MAGARAAAAAASAGSSASSGNQPPQELGLGELLEEFSRTQYRAKDGSGTGGSKVERIEKRCLELFGRDYC      1 - 70
FSVIPNTNGDICGHYPRHIVFLEYESSEKEKDTFESTVQVSKLQDLIHRSKMARCRGRFVCPVILFKGKH     71 - 140
ICRSATLAGWGELYGRSGYNYFFSGGADDAWADVEDVTEEDCALRSGDTHLFDKVRGYDIKLLRYLSVKY    141 - 210
ICDLMVENKKVKFGMNVTSSEKVDKAQRYADFTLLSIPYPGCEFFKEYKDRDYMAEGLIFNWKQDYVDAP    211 - 280
LSIPDFLTHSLNIDWSQYQCWDLVQQTQNYLKLLLSLVNSDDDSGLLVHCISGWDRTPLFISLLRLSLWA    281 - 350
DGLIHTSLKPTEILYLTVAYDWFLFGHMLVDRLSKGEEIFFFCFNFLKHITSEEFSALKTQRRKSLPARD    351 - 420
GGFTLEDICMLRRKDRGSTTSLGSDFSLVMESSPGATGSFTYEAVELVPAGAPTQAAWRKSHSSSPQSVL    421 - 490
WNRPQPSEDRLPSQQGLAEARSSSSSSSNHSDNFFRMGSSPLEVPKPRSVDHPLPGSSLSTDYGSWQMVT    491 - 560
GCGSIQERAVLHTDSSLPFSFPDELPNSCLLAALSDRETRLQEVRSAFLAAYSSTVGLRAVAPSPSGAIG    561 - 630
GLLEQFARGVGLRSISSNAL                                                      631 - 650
//

Text Mined References (22)

PMID Year Title