Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.89
PubTator Score 1.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
Rheumatoid arthritis 1191 4.3e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Glycogen storage disease 39 4.139 2.1

Expression

  Differential Expression (1)

Disease log2 FC p
Rheumatoid arthritis 1.200 4.3e-02

Gene RIF (1)

AA Sequence

MAWPNVFQRGSLLSQFSHHHVVVFLLTFFSYSLLHASRKTFSNVKVSISEQWTPSAFNTSVELPVEIWSS      1 - 70
NHLFPSAEKATLFLGTLDTIFLFSYAVGLFISGIVGDRLNLRWVLSFGMCSSALVVFVFGALTEWLRFYN     71 - 140
KWLYCCLWIVNGLLQSTGWPCVVAVMGNWFGKAGRGVVFGLWSACASVGNILGACLASSVLQYGYEYAFL    141 - 210
VTASVQFAGGIVIFFGLLVSPEEIGLSGIEAEENFEEDSHRPLINGGENEDEYEPNYSIQDDSSVAQVKA    211 - 280
ISFYQACCLPGVIPYSLAYACLKLVNYSFFFWLPFYLSNNFGWKEAEADKLSIWYDVGGIIGGTLQGFIS    281 - 350
DVLQKRAPVLALSLLLAVGSLIGYSRSPNDKSINALLMTVTGFFIGGPSNMISSAISADLGRQELIQRSS    351 - 420
EALATVTGIVDGSGSIGAAVGQYLVSLIRDKLGWMWVFYFFILMTSCTIVFISPLIVREIFSLVLRRQAH    421 - 490
ILRE                                                                      491 - 494
//

Text Mined References (11)

PMID Year Title