Property Summary

NCBI Gene PubMed Count 8
Grant Count 1
Funding $167,106
PubMed Score 2.06
PubTator Score 1.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (1)

Disease log2 FC p
Rheumatoid Arthritis 1.200 0.043

Synonym

Accession Q8NCC5 Q6PIU7 Q86SS4 Q9BQG7
Symbols

Gene

PANTHER Protein Class (2)

 Grant Application (1)

Gene RIF (1)

PMID Text
21752829 SLC37A3 protein localizes in lysosomes in HeLa cells

AA Sequence

MAWPNVFQRGSLLSQFSHHHVVVFLLTFFSYSLLHASRKTFSNVKVSISEQWTPSAFNTSVELPVEIWSS      1 - 70
NHLFPSAEKATLFLGTLDTIFLFSYAVGLFISGIVGDRLNLRWVLSFGMCSSALVVFVFGALTEWLRFYN     71 - 140
KWLYCCLWIVNGLLQSTGWPCVVAVMGNWFGKAGRGVVFGLWSACASVGNILGACLASSVLQYGYEYAFL    141 - 210
VTASVQFAGGIVIFFGLLVSPEEIGLSGIEAEENFEEDSHRPLINGGENEDEYEPNYSIQDDSSVAQVKA    211 - 280
ISFYQACCLPGVIPYSLAYACLKLVNYSFFFWLPFYLSNNFGWKEAEADKLSIWYDVGGIIGGTLQGFIS    281 - 350
DVLQKRAPVLALSLLLAVGSLIGYSRSPNDKSINALLMTVTGFFIGGPSNMISSAISADLGRQELIQRSS    351 - 420
EALATVTGIVDGSGSIGAAVGQYLVSLIRDKLGWMWVFYFFILMTSCTIVFISPLIVREIFSLVLRRQAH    421 - 490
ILRE                                                                      491 - 494
//

Text Mined References (11)

PMID Year Title
21949678 2011 SLC37A1 and SLC37A2 are phosphate-linked, glucose-6-phosphate antiporters.
21752829 2011 Characterization of the CLEAR network reveals an integrated control of cellular clearance pathways.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12811562 2004 The human sugar-phosphate/phosphate exchanger family SLC37.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
9847074 1998 Toward a complete human genome sequence.
More...