Property Summary

NCBI Gene PubMed Count 13
Grant Count 11
R01 Count 5
Funding $3,342,530.4
PubMed Score 44.56
PubTator Score 10.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
nephrosclerosis 1.975 0.005
malignant mesothelioma 2.200 0.000
posterior fossa group B ependymoma -2.600 0.000
oligodendroglioma -1.500 0.016
psoriasis 1.900 0.000
osteosarcoma 2.144 0.012
cystic fibrosis 1.173 0.000
Atopic dermatitis 1.300 0.002
adrenocortical carcinoma 2.199 0.000
non-small cell lung cancer 2.049 0.000
lung cancer 1.500 0.000
active ulcerative colitis -2.480 0.004
fibroadenoma 1.200 0.004
Breast cancer 3.400 0.048
group 4 medulloblastoma 1.500 0.009
non primary Sjogren syndrome sicca -1.100 0.015
subependymal giant cell astrocytoma -1.993 0.023
severe Alzheimer's disease -1.217 0.034
lung adenocarcinoma 1.142 0.007
lung carcinoma 1.300 0.000
Pick disease -1.500 0.008
ductal carcinoma in situ 1.300 0.006
invasive ductal carcinoma 2.100 0.050
acute myeloid leukemia 1.500 0.041
ovarian cancer 1.100 0.007

Gene RIF (4)

PMID Text
26699544 NETO2 upregulation could serve as a potential biomarker for the prediction of advanced tumor progression and unfavorable prognosis in patients with colorectal carcinoma.
26277340 Results suggested that the extracellular N-terminal region including the two CUB domains was largely responsible for the distinct regulatory effects of Neto1 and Neto2 on the desensitization properties of GluK1 homomeric receptors
19217376 Rat neto2 plays a role in glutamate signaling in the brain by modulating the function of kainate receptors.
15340161 Determination of the neuropilin and tolloid-like protein 2 signal peptide cleavage site by N-terminal sequencing.

AA Sequence

MALERLCSVLKVLLITVLVVEGIAVAQKTQDGQNIGIKHIPATQCGIWVRTSNGGHFASPNYPDSYPPNK      1 - 70
ECIYILEAAPRQRIELTFDEHYYIEPSFECRFDHLEVRDGPFGFSPLIDRYCGVKSPPLIRSTGRFMWIK     71 - 140
FSSDEELEGLGFRAKYSFIPDPDFTYLGGILNPIPDCQFELSGADGIVRSSQVEQEEKTKPGQAVDCIWT    141 - 210
IKATPKAKIYLRFLDYQMEHSNECKRNFVAVYDGSSSIENLKAKFCSTVANDVMLKTGIGVIRMWADEGS    211 - 280
RLSRFRMLFTSFVEPPCTSSTFFCHSNMCINNSLVCNGVQNCAYPWDENHCKEKKKAGVFEQITKTHGTI    281 - 350
IGITSGIVLVLLIISILVQVKQPRKKVMACKTAFNKTGFQEVFDPPHYELFSLRDKEISADLADLSEELD    351 - 420
NYQKMRRSSTASRCIHDHHCGSQASSVKQSRTNLSSMELPFRNDFAQPQPMKTFNSTFKKSSYTFKQGHE    421 - 490
CPEQALEDRVMEEIPCEIYVRGREDSAQASISIDF                                       491 - 525
//

Text Mined References (15)

PMID Year Title
26699544 2015 Upregulation of NETO2 expression correlates with tumor progression and poor prognosis in colorectal carcinoma.
26277340 2015 The auxiliary subunits Neto1 and Neto2 have distinct, subunit-dependent effects at recombinant GluK1- and GluK2-containing kainate receptors.
19349369 2009 Identification of signaling systems in proliferating and involuting phase infantile hemangiomas by genome-wide transcriptional profiling.
19217376 2009 A transmembrane accessory subunit that modulates kainate-type glutamate receptors.
18841201 2008 Identification of nuclear and cytoplasmic mRNA targets for the shuttling protein SF2/ASF.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17671192 2007 Nm23-H1 suppresses tumor cell motility by down-regulating the lysophosphatidic acid receptor EDG2.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...