Property Summary

NCBI Gene PubMed Count 13
PubMed Score 1.33
PubTator Score 0.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Gene RIF (1)

AA Sequence

MAWRRREASVGARGVLALALLALALCVPGARGRALEWFSAVVNIEYVDPQTNLTVWSVSESGRFGDSSPK      1 - 70
EGAHGLVGVPWAPGGDLEGCAPDTRFFVPEPGGRGAAPWVALVARGGCTFKDKVLVAARRNASAVVLYNE     71 - 140
ERYGNITLPMSHAGTGNIVVIMISYPKGREILELVQKGIPVTMTIGVGTRHVQEFISGQSVVFVAIAFIT    141 - 210
MMIISLAWLIFYYIQRFLYTGSQIGSQSHRKETKKVIGQLLLHTVKHGEKGIDVDAENCAVCIENFKVKD    211 - 280
IIRILPCKHIFHRICIDPWLLDHRTCPMCKLDVIKALGYWGEPGDVQEMPAPESPPGRDPAANLSLALPD    281 - 350
DDGSDDSSPPSASPAESEPQCDPSFKGDAGENTALLEAGRSDSRHGGPIS                        351 - 400
//

Text Mined References (15)

PMID Year Title