Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.39
PubTator Score 1.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
posterior fossa group A ependymoma -1.800 0.000
glioblastoma -1.100 0.000
sonic hedgehog group medulloblastoma -1.400 0.000
atypical teratoid/rhabdoid tumor -1.700 0.000
pediatric high grade glioma -1.300 0.000
pilocytic astrocytoma -1.200 0.000
psoriasis 1.300 0.000

Gene RIF (2)

PMID Text
19969290 report that overexpression of RELT or its homologues RELL1 and RELL2 in HEK 293 epithelial cells results in cell death with morphological characteristics consistent with the activation of an apoptotic pathway.
16389068 Binds to the TNF receptor family member RELT; homologue of RELT.

AA Sequence

MSEPQPDLEPPQHGLYMLFLLVLVFFLMGLVGFMICHVLKKKGYRCRTSRGSEPDDAQLQPPEDDDMNED      1 - 70
TVERIVRCIIQNEANAEALKEMLGDSEGEGTVQLSSVDATSSLQDGAPSHHHTVHLGSAAPCLHCSRSKR     71 - 140
PPLVRQGRSKEGKSRPRTGETTVFSVGRFRVTHIEKRYGLHEHRDGSPTDRSWGSGGGQDPGGGQGSGGG    141 - 210
QPKAGMPAMERLPPERPQPQVLASPPVQNGGLRDSSLTPRALEGNPRASAEPTLRAGGRGPSPGLPTQEA    211 - 280
NGQPSKPDTSDHQVSLPQGAGSM                                                   281 - 303
//

Text Mined References (8)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
19969290 2010 RELT induces cellular death in HEK 293 epithelial cells.
16389068 2006 Identification of RELT homologues that associate with RELT and are phosphorylated by OSR1.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.