Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.46
PubTator Score 1.08

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -1.100 1.5e-03
Astrocytoma, Pilocytic -1.200 3.0e-07
atypical teratoid / rhabdoid tumor -1.500 1.3e-09
ependymoma -1.700 7.1e-18
glioblastoma -1.100 4.6e-07
group 3 medulloblastoma -1.100 6.9e-03
psoriasis 1.300 3.0e-34

Gene RIF (2)

AA Sequence

MSEPQPDLEPPQHGLYMLFLLVLVFFLMGLVGFMICHVLKKKGYRCRTSRGSEPDDAQLQPPEDDDMNED      1 - 70
TVERIVRCIIQNEANAEALKEMLGDSEGEGTVQLSSVDATSSLQDGAPSHHHTVHLGSAAPCLHCSRSKR     71 - 140
PPLVRQGRSKEGKSRPRTGETTVFSVGRFRVTHIEKRYGLHEHRDGSPTDRSWGSGGGQDPGGGQGSGGG    141 - 210
QPKAGMPAMERLPPERPQPQVLASPPVQNGGLRDSSLTPRALEGNPRASAEPTLRAGGRGPSPGLPTQEA    211 - 280
NGQPSKPDTSDHQVSLPQGAGSM                                                   281 - 303
//

Text Mined References (8)

PMID Year Title