Property Summary

NCBI Gene PubMed Count 14
PubMed Score 3.95
PubTator Score 5.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count
Behcet Syndrome 21
Disease Target Count P-value
ovarian cancer 8520 1.4e-04
Disease Target Count Z-score Confidence
Crohn's disease 321 0.0 3.0
Skin cancer 469 0.0 3.0
Disease Target Count Z-score Confidence
Behcet's disease 89 4.921 2.5
Disease Target Count
Behcet's syndrome 50

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.500 1.4e-04

Protein-protein Interaction (8)

Gene RIF (3)

AA Sequence

MFTSTGSSGLYKAPLSKSLLLVPSALSLLLALLLPHCQKLFVYDLHAVKNDFQIWRLICGRIICLDLKDT      1 - 70
FCSSLLIYNFRIFERRYGSRKFASFLLGSWVLSALFDFLLIEAMQYFFGITAASNLPSGFLAPVFALFVP     71 - 140
FYCSIPRVQVAQILGPLSITNKTLIYILGLQLFTSGSYIWIVAISGLMSGLCYDSKMFQVHQVLCIPSWM    141 - 210
AKFFSWTLEPIFSSSEPTSEARIGMGATLDIQRQQRMELLDRQLMFSQFAQGRRQRQQQGGMINWNRLFP    211 - 280
PLRQRQNVNYQGGRQSEPAAPPLEVSEEQVARLMEMGFSRGDALEALRASNNDLNVATNFLLQH          281 - 344
//

Text Mined References (14)

PMID Year Title