Property Summary

NCBI Gene PubMed Count 14
PubMed Score 2.69
PubTator Score 5.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.500 0.000

Gene RIF (3)

PMID Text
22455605 UBAC2 is associated with Behcet's disease in Chinese patients and implicates its involvement in transcriptional modulation.
21918955 We established and confirmed the genetic association between UBAC2 and Behcet's disease in 3 independent sets of patients and controls
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MFTSTGSSGLYKAPLSKSLLLVPSALSLLLALLLPHCQKLFVYDLHAVKNDFQIWRLICGRIICLDLKDT      1 - 70
FCSSLLIYNFRIFERRYGSRKFASFLLGSWVLSALFDFLLIEAMQYFFGITAASNLPSGFLAPVFALFVP     71 - 140
FYCSIPRVQVAQILGPLSITNKTLIYILGLQLFTSGSYIWIVAISGLMSGLCYDSKMFQVHQVLCIPSWM    141 - 210
AKFFSWTLEPIFSSSEPTSEARIGMGATLDIQRQQRMELLDRQLMFSQFAQGRRQRQQQGGMINWNRLFP    211 - 280
PLRQRQNVNYQGGRQSEPAAPPLEVSEEQVARLMEMGFSRGDALEALRASNNDLNVATNFLLQH          281 - 344
//

Text Mined References (14)

PMID Year Title
25660456 2015 Identification of ERAD components essential for dislocation of the null Hong Kong variant of ?-1-antitrypsin (NHK).
25416956 2014 A proteome-scale map of the human interactome network.
23297223 2013 Spatial regulation of UBXD8 and p97/VCP controls ATGL-mediated lipid droplet turnover.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22455605 2012 Replication study confirms the association between UBAC2 and Behçet's disease in two independent Chinese sets of patients and controls.
21918955 2011 A putative functional variant within the UBAC2 gene is associated with increased risk of Behçet's disease.
21700618 2011 Genome-wide association study identifies novel alleles associated with risk of cutaneous basal cell carcinoma and squamous cell carcinoma.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...