Property Summary

NCBI Gene PubMed Count 10
PubMed Score 4.64
PubTator Score 6.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Spinocerebellar Ataxias 34 0.0 0.0
Disease Target Count P-value
lung carcinoma 2843 4.7e-68
cystic fibrosis 1696 1.1e-05
group 3 medulloblastoma 4104 7.2e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.6
Disease Target Count Z-score Confidence
Orofacial cleft 54 0.0 3.0
Disease Target Count Z-score Confidence
Neurodegenerative disease 414 0.0 4.0
Disease Target Count Z-score Confidence
Episodic ataxia 22 3.44 1.7
Meniere's disease 24 3.437 1.7

Expression

  Differential Expression (3)

Disease log2 FC p
cystic fibrosis 2.746 1.1e-05
group 3 medulloblastoma 1.200 7.2e-04
lung carcinoma 4.800 4.7e-68

Gene RIF (5)

AA Sequence

MAIEGGERTCGVHELICIRKVSPEAVGFLSAVGVFIILMLLLFLYINKKFCFENVGGFPDLGSEYSTRKN      1 - 70
SQDKIYNSYMDKDEHGSSSESEDEALGKYHEALSRTHNSRLPLADSRQRNYAWETRQKYSPLSAEYDGYS     71 - 140
SEASIDEGNCIQRMRRTPPLDELQPPPYQDDSGSPHLSCTPSEIGDSKCEFSHCSNSPRCSYNKCPSEGS    141 - 210
TGHEIESFHNKGYEEDVPSDSTAVLSPEDMSAQGSSSQLPKPFDPEPEAKYGTLDVTFDYDSQEQKLLVT    211 - 280
VTAVTDIPTYNRTGGNSWQVHLVLLPIKKQRAKTSIQRGPCPVFTETFKFNHVESEMIGNYAVRFRLYGV    281 - 350
HRMKKEKIVGEKIFYLTKLNLQGKMSLPVILEPSYNHSGCDSQMSVSEMSCSESTSSCQSLEHGSVPEIL    351 - 420
IGLLYNATTGRLSAEVIKGSHFKNLAANRPPNTYVKLTLLNSMGQEMSKCKTSIRRGQPNPVYKETFVFQ    421 - 490
VALFQLSDVTLILSVYNKRSMKRKEMIGWISLGLNSSGEEELNHWTEMKESKGQQVCRWHALLES         491 - 555
//

Text Mined References (11)

PMID Year Title