Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.29
PubTator Score 0.73

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
active Crohn's disease 1.184 1.1e-02
invasive ductal carcinoma 1.200 3.0e-04
osteosarcoma -1.147 1.4e-04
ovarian cancer 1.300 2.2e-02
pancreatic ductal adenocarcinoma liver m... -1.560 3.1e-02
spina bifida -1.394 3.6e-02
tuberculosis and treatment for 3 months -1.100 9.7e-04

Protein-protein Interaction (3)

AA Sequence

MDKILEGLVSSSHPLPLKRVIVRKVVESAEHWLDEAQCEAMFDLTTRLILEGQDPFQRQVGHQVLEAYAR      1 - 70
YHRPEFESFFNKTFVLGLLHQGYHSLDRKDVAILDYIHNGLKLIMSCPSVLDLFSLLQVEVLRMVCERPE     71 - 140
PQLCARLSDLLTDFVQCIPKGKLSITFCQQLVRTIGHFQCVSTQERELREYVSQVTKVSNLLQNIWKAEP    141 - 210
ATLLPSLQEVFASISSTDASFEPSVALASLVQHIPLQMITVLIRSLTTDPNVKDASMTQALCRMIDWLSW    211 - 280
PLAQHVDTWVIALLKGLAAVQKFTILIDVTLLKIELVFNRLWFPLVRPGALAVLSHMLLSFQHSPEAFHL    281 - 350
IVPHVVNLVHSFKNDGLPSSTAFLVQLTELIHCMMYHYSGFPDLYEPILEAIKDFPKPSEEKIKLILNQS    351 - 420
AWTSQSNSLASCLSRLSGKSETGKTGLINLGNTCYMNSVIQALFMATDFRRQVLSLNLNGCNSLMKKLQH    421 - 490
LFAFLAHTQREAYAPRIFFEASRPPWFTPRSQQDCSEYLRFLLDRLHEEEKILKVQASHKPSEILECSET    491 - 560
SLQEVASKAAVLTETPRTSDGEKTLIEKMFGGKLRTHIRCLNCRSTSQKVEAFTDLSLAFCPSSSLENMS    561 - 630
VQDPASSPSIQDGGLMQASVPGPSEEPVVYNPTTAAFICDSLVNEKTIGSPPNEFYCSENTSVPNESNKI    631 - 700
LVNKDVPQKPGGETTPSVTDLLNYFLAPEILTGDNQYYCENCASLQNAEKTMQITEEPEYLILTLLRFSY    701 - 770
DQKYHVRRKILDNVSLPLVLELPVKRITSFSSLSESWSVDVDFTDLSENLAKKLKPSGTDEASCTKLVPY    771 - 840
LLSSVVVHSGISSESGHYYSYARNITSTDSSYQMYHQSEALALASSQSHLLGRDSPSAVFEQDLENKEMS    841 - 910
KEWFLFNDSRVTFTSFQSVQKITSRFPKDTAYVLLYKKQHSTNGLSGNNPTSGLWINGDPPLQKELMDAI    911 - 980
TKDNKLYLQEQELNARARALQAASASCSFRPNGFDDNDPPGSCGPTGGGGGGGFNTVGRLVF            981 - 1042
//

Text Mined References (10)

PMID Year Title