Property Summary

NCBI Gene PubMed Count 15
Grant Count 8
R01 Count 1
Funding $1,078,952.83
PubMed Score 17.84
PubTator Score 6.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
Breast cancer -1.800 0.000

Gene RIF (5)

PMID Text
26799706 SMYD1 serves as an Serum Response Factor-interacting protein, enhances Serum Response Factor DNA binding activity, and is required for endothelial cell migration and tube formation to regulate angiogenesis.
25644430 SMYD1 and G6PD modulation are critical events for miR-206-mediated differentiation of rhabdomyosarcoma.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19162039 HDGF functions as a transcriptional repressor of the SMYD1 gene through interaction with the transcriptional corepressor CtBP.
12858532 effects of gene mutations on ventricular development

AA Sequence

MTIGRMENVEVFTAEGKGRGLKATKEFWAADIIFAERAYSAVVFDSLVNFVCHTCFKRQEKLHRCGQCKF      1 - 70
AHYCDRTCQKDAWLNHKNECSAIKRYGKVPNENIRLAARIMWRVEREGTGLTEGCLVSVDDLQNHVEHFG     71 - 140
EEEQKDLRVDVDTFLQYWPPQSQQFSMQYISHIFGVINCNGFTLSDQRGLQAVGVGIFPNLGLVNHDCWP    141 - 210
NCTVIFNNGNHEAVKSMFHTQMRIELRALGKISEGEELTVSYIDFLNVSEERKRQLKKQYYFDCTCEHCQ    211 - 280
KKLKDDLFLGVKDNPKPSQEVVKEMIQFSKDTLEKIDKARSEGLYHEVVKLCRECLEKQEPVFADTNIYM    281 - 350
LRMLSIVSEVLSYLQAFEEASFYARRMVDGYMKLYHPNNAQLGMAVMRAGLTNWHAGNIEVGHGMICKAY    351 - 420
AILLVTHGPSHPITKDLEAMRVQTEMELRMFRQNEFMYYKMREAALNNQPMQVMAEPSNEPSPALFHKKQ    421 - 490
//

Text Mined References (17)

PMID Year Title
26799706 2016 SMYD1, an SRF-Interacting Partner, Is Involved in Angiogenesis.
25644430 2015 SMYD1 and G6PD modulation are critical events for miR-206-mediated differentiation of rhabdomyosarcoma.
25416956 2014 A proteome-scale map of the human interactome network.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19783823 2009 SMYD1, the myogenic activator, is a direct target of serum response factor and myogenin.
19162039 2009 Hepatoma-derived growth factor represses SET and MYND domain containing 1 gene expression through interaction with C-terminal binding protein.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
More...