Property Summary

NCBI Gene PubMed Count 15
PubMed Score 18.75
PubTator Score 6.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
Breast cancer 3578 1.7e-62
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Melanoma 711 0.0 0.5
Disease Target Count Z-score Confidence
Axenfeld-Rieger syndrome 14 3.305 1.7
Congenital heart disease 93 3.195 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
Breast cancer -1.800 1.7e-62

Gene RIF (5)

AA Sequence

MTIGRMENVEVFTAEGKGRGLKATKEFWAADIIFAERAYSAVVFDSLVNFVCHTCFKRQEKLHRCGQCKF      1 - 70
AHYCDRTCQKDAWLNHKNECSAIKRYGKVPNENIRLAARIMWRVEREGTGLTEGCLVSVDDLQNHVEHFG     71 - 140
EEEQKDLRVDVDTFLQYWPPQSQQFSMQYISHIFGVINCNGFTLSDQRGLQAVGVGIFPNLGLVNHDCWP    141 - 210
NCTVIFNNGNHEAVKSMFHTQMRIELRALGKISEGEELTVSYIDFLNVSEERKRQLKKQYYFDCTCEHCQ    211 - 280
KKLKDDLFLGVKDNPKPSQEVVKEMIQFSKDTLEKIDKARSEGLYHEVVKLCRECLEKQEPVFADTNIYM    281 - 350
LRMLSIVSEVLSYLQAFEEASFYARRMVDGYMKLYHPNNAQLGMAVMRAGLTNWHAGNIEVGHGMICKAY    351 - 420
AILLVTHGPSHPITKDLEAMRVQTEMELRMFRQNEFMYYKMREAALNNQPMQVMAEPSNEPSPALFHKKQ    421 - 490
//

Text Mined References (17)

PMID Year Title