Property Summary

NCBI Gene PubMed Count 5
PubMed Score 2.27
PubTator Score 0.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
ECTODERMAL DYSPLASIA 12, HYPOHIDROTIC/HAIR/TOOTH/NAIL TYPE 1 0.0 0.0
Disease Target Count P-value
invasive ductal carcinoma 2951 1.1e-03
ductal carcinoma in situ 1745 2.1e-03
interstitial cystitis 2312 2.7e-03
breast carcinoma 1638 1.1e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Hypohidrotic ectodermal dysplasia 15 4.897 2.4

Expression

  Differential Expression (4)

Disease log2 FC p
breast carcinoma 1.300 1.1e-02
ductal carcinoma in situ 1.100 2.1e-03
interstitial cystitis -1.300 2.7e-03
invasive ductal carcinoma 1.400 1.1e-03

Gene RIF (1)

AA Sequence

MPRPGHPRPASGPPRLGPWERPTELCLETYDKPPQPPPSRRTRRPDPKDPGHHGPESITFISGSAEPALE      1 - 70
SPTCCLLWRPWVWEWCRAAFCFRRCRDCLQRCGACVRGCSPCLSTEDSTEGTAEANWAKEHNGVPPSPDR     71 - 140
APPSRRDGQRLKSTMGSSFSYPDVKLKGIPVYPYPRATSPAPDADSCCKEPLADPPPMRHSLPSTFASSP    141 - 210
RGSEEYYSFHESDLDLPEMGSGSMSSREIDVLIFKKLTELFSVHQIDELAKCTSDTVFLEKTSKISDLIS    211 - 280
SITQDYHLDEQDAEGRLVRGIIRISTRKSRARPQTSEGRSTRAAAPTAAAPDSGHETMVGSGLSQDELTV    281 - 350
QISQETTADAIARKLRPYGAPGYPASHDSSFQGTDTDSSGAPLLQVYC                          351 - 398
//

Text Mined References (8)

PMID Year Title