Property Summary

NCBI Gene PubMed Count 11
PubMed Score 5.30
PubTator Score 2.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Acne 52 3.524 1.8

Expression

  Differential Expression (4)

Disease log2 FC p
non-small cell lung cancer -1.080 1.2e-13
osteosarcoma -1.442 3.8e-05
ovarian cancer -1.200 5.0e-04
tuberculosis and treatment for 6 months -1.100 6.7e-07

Gene RIF (2)

AA Sequence

MANRTVKDAHSIHGTNPQYLVEKIIRTRIYESKYWKEECFGLTAELVVDKAMELRFVGGVYGGNIKPTPF      1 - 70
LCLTLKMLQIQPEKDIIVEFIKNEDFKYVRMLGALYMRLTGTAIDCYKYLEPLYNDYRKIKSQNRNGEFE     71 - 140
LMHVDEFIDELLHSERVCDIILPRLQKRYVLEEAEQLEPRVSALEEDMDDVESSEEEEEEDEKLERVPSP    141 - 210
DHRRRSYRDLDKPRRSPTLRYRRSRSRSPRRRSRSPKRRSPSPRRERHRSKSPRRHRSRSRDRRHRSRSK    211 - 280
SPGHHRSHRHRSHSKSPERSKKSHKKSRRGNE                                          281 - 312
//

Text Mined References (23)

PMID Year Title