Property Summary

NCBI Gene PubMed Count 10
PubMed Score 4.80
PubTator Score 2.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.442 0.000
tuberculosis and treatment for 6 months -1.100 0.000
non-small cell lung cancer -1.080 0.000
ovarian cancer -1.200 0.000

Synonym

Accession Q8NAV1 Q96JW1 Q9BVZ8
Symbols Prp38
PRP38A

Gene

PDB

4RZ9   4RZA  

Gene RIF (2)

PMID Text
26673105 Multiple protein-protein interactions are converging on the Prp38 protein during activation of the human spliceosome.
18854154 Knockdown of PRP38 pre-mRNA processing factor 38 domain containing A (PRPF38A) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1

AA Sequence

MANRTVKDAHSIHGTNPQYLVEKIIRTRIYESKYWKEECFGLTAELVVDKAMELRFVGGVYGGNIKPTPF      1 - 70
LCLTLKMLQIQPEKDIIVEFIKNEDFKYVRMLGALYMRLTGTAIDCYKYLEPLYNDYRKIKSQNRNGEFE     71 - 140
LMHVDEFIDELLHSERVCDIILPRLQKRYVLEEAEQLEPRVSALEEDMDDVESSEEEEEEDEKLERVPSP    141 - 210
DHRRRSYRDLDKPRRSPTLRYRRSRSRSPRRRSRSPKRRSPSPRRERHRSKSPRRHRSRSRDRRHRSRSK    211 - 280
SPGHHRSHRHRSHSKSPERSKKSHKKSRRGNE                                          281 - 312
//

Text Mined References (22)

PMID Year Title
26673105 2016 Multiple protein-protein interactions converging on the Prp38 protein during activation of the human spliceosome.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
More...