Property Summary

NCBI Gene PubMed Count 5
PubMed Score 95.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma -1.400 4.2e-05
atypical teratoid / rhabdoid tumor -1.900 5.0e-05
glioblastoma -1.200 1.9e-04
medulloblastoma, large-cell -2.500 4.1e-07
osteosarcoma -1.659 2.5e-06
subependymal giant cell astrocytoma -1.265 1.5e-02

AA Sequence

MSCRGRGAGGRWNSTSWSTGCKLPASPRRVSRCSPTGLIKLAFLFSKTRCKFFSLTETPEDYTIIVDEEG      1 - 70
FLELPSSEHLSVADATWLALNVVSGGGSFSSSQPIGMTKIAKSVIAPLADQNISVFMLSTYQTDFILVLK     71 - 140
RDLPFVTHTLSSEFTILWSVARL                                                   141 - 163
//

Text Mined References (7)

PMID Year Title