Property Summary

NCBI Gene PubMed Count 5
PubMed Score 88.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
medulloblastoma, large-cell 6234 4.07862021485917E-7
osteosarcoma 7933 2.50862791429316E-6
atypical teratoid / rhabdoid tumor 4369 5.0474420652914E-5
pediatric high grade glioma 2712 0.00405122083188868
glioblastoma 5572 0.00954209853522655
subependymal giant cell astrocytoma 2287 0.0145296635202768
Disease Target Count Z-score Confidence
Epilepsy 346 3.843 1.9
Disease Target Count
Premature ovarian failure 8 2

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -1.659 0.000
glioblastoma -1.600 0.010
atypical teratoid / rhabdoid tumor -1.900 0.000
medulloblastoma, large-cell -2.500 0.000
pediatric high grade glioma -1.500 0.004
subependymal giant cell astrocytoma -1.265 0.015

AA Sequence

MSCRGRGAGGRWNSTSWSTGCKLPASPRRVSRCSPTGLIKLAFLFSKTRCKFFSLTETPEDYTIIVDEEG      1 - 70
FLELPSSEHLSVADATWLALNVVSGGGSFSSSQPIGMTKIAKSVIAPLADQNISVFMLSTYQTDFILVLK     71 - 140
RDLPFVTHTLSSEFTILWSVARL                                                   141 - 163
//

Text Mined References (7)

PMID Year Title
25343990 2015 Genome-wide association study of selenium concentrations.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.