Property Summary

NCBI Gene PubMed Count 5
Grant Count 8
Funding $76,223.98
PubMed Score 88.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -1.659 0.000
glioblastoma -1.600 0.010
atypical teratoid / rhabdoid tumor -1.900 0.000
medulloblastoma, large-cell -2.500 0.000
pediatric high grade glioma -1.500 0.004
subependymal giant cell astrocytoma -1.265 0.015

AA Sequence

MSCRGRGAGGRWNSTSWSTGCKLPASPRRVSRCSPTGLIKLAFLFSKTRCKFFSLTETPEDYTIIVDEEG      1 - 70
FLELPSSEHLSVADATWLALNVVSGGGSFSSSQPIGMTKIAKSVIAPLADQNISVFMLSTYQTDFILVLK     71 - 140
RDLPFVTHTLSSEFTILWSVARL                                                   141 - 163
//

Text Mined References (7)

PMID Year Title
25343990 2015 Genome-wide association study of selenium concentrations.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.